Campbell Biology
12th Edition
ISBN: 9780135188743
Author: Urry
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Question
Chapter 19.2, Problem 3CC
Summary Introduction
To propose a hypothesis: To compare viral and cellular RNA polymerase in terms of template and functions.
Concept introduction: Cellular RNA polymerase is an enzyme found in all organisms. Viral RNA polymerases play an important role in replication and transcription of virus. Replication is a process of synthesizing an exact copy from the parent or template strand. Transcription is a process where RNA is formed using DNA or RNA as a template.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
BONUS: Why do RNA viruses such as the COVID coronavirus, influenza virus and HIV have much
higher mutation rates than DNA viruses such as Herpes viruses?
O DNA polymerases which copy viral RNA have much higher mutation rates than RNA polymerases which copy
viral DNA
O RNA polymerases which copy viral RNA have much higher mutation rates than DNA polymerases which copy
viral DNA
RNA viral 60S ribosomes make many ore mutations than DNA viral 40S ribosomes
O RNA viral gyrases make more mistakes than DNA viral helicases
Virology
The diagrams below represent nucleic acid genomic material and a finished product after
the viral polymerase acted on the genomic material. Name the virus (either family, genus,
or particular virus is acceptable) that these diagrams represent.
A is
B is
C is
Dis
Genomic material
Product
+ sense RNA
A 5' VPB
-sense RNA
3'
VPg 5'
-sense RNA
5' cap
Derived from infected cell
B
3'
5'
AAAAA(A) 3
+ sense RNA
C
+ sense RNA
-sense RNA
+sense RNA
5'
3'
Chapter 19 Solutions
Campbell Biology
Ch. 19.1 - Prob. 1CCCh. 19.1 - Prob. 2CCCh. 19.2 - Compare the effect on the host cell of a lytic...Ch. 19.2 - MAKE CONNECTIONS Compare the CRISPR-Cas system to...Ch. 19.2 - Prob. 3CCCh. 19.2 - Why is HIV called a retrovirus?Ch. 19.2 - Prob. 5CCCh. 19.3 - Describe two ways in which a preexisting virus can...Ch. 19.3 - Contrast horizontal and vertical transmission of...Ch. 19.3 - WHAT IF? TMV has been isolated from virtually all...
Ch. 19 - Are viruses generally considered living or...Ch. 19 - Prob. 19.2CRCh. 19 - Prob. 19.3CRCh. 19 - Which of the following characteristics,...Ch. 19 - Emerging viruses arise by (A) mutation of existing...Ch. 19 - Prob. 3TYUCh. 19 - Prob. 4TYUCh. 19 - Prob. 5TYUCh. 19 - DRAW IT Redraw Figure 19.8 to show the replicative...Ch. 19 - EVOLUTION CONNECTION The successof some viruses...Ch. 19 - SCIENTIFIC INQUIRY When bacteria infect an animal,...Ch. 19 - WRITE ABOUT A THEME: ORGANIZATION While viruses...Ch. 19 - Prob. 10TYU
Knowledge Booster
Similar questions
- Microb an mRNA molecule has the sequence 5'UCA GAA AUG CAC3. Which of the following best describes the tRNA that binds to the third/3rd codon of this mRNA? has anticodon AUG and the amino acid tyrosine It can have any anticodon and any amino acid Has the anticodon UAC and the amino acid methionine Has the anticodon CUU and the amino acid glutamic acid must have the anticodon TAC Has anticodon UUC and the amino acid lysinearrow_forwardHow are poly-adenosine tails added to subgenomic mRNAs of RNA viruses? Repeated uracil bases on the template cause the polymerase to slip backwards and recopy the sequence Polymerases copy a 200 base string of uracils found in some RNA viral genomes Polymerases copy a 200 base string of uracils added to the template during circularization Viral mRNAs undergo post-translational modifications, which include splicing of introns, a 5'-cap, and a 3'-poly-A tailarrow_forwardA virus that has which type of genome must carry replicase within the viral particle? (choose all that apply) ds DNA ss (+) DNA ss (–) DNA ss (+) RNA ss (–) RNA Which viral type has a genome that can be directly translated? (choose all that apply) ds DNA ss (+) DNA ss (–) DNA ss (+) RNA ss (–) RNAarrow_forward
- Name each of the processes pictured: -RNA 5' TCAC CÁCTCAT 3' TACCACCTA 3' UUCAC CACUCAU U 5' DŇA RNA polymerase Primary RNA transcript Exon 1 Intron Exon 2 Intron Exon 3 Spliced RNA 000 Exon 1 Exon 2 Exon 3 AAAAAAA polypeptide chain Met Phe Arg P E UAC AAA GCU AUGUUUCGA Ribosome There are possible nucleotide "triplets" orarrow_forwardExplain the Gene Expression Experiment Re-Analysis Summary of Rabies Virus(Taxon:11292) Explain how The virus attaches to the cell membrane of the host cell via the G protein. How the virus penetrates the cytoplasm and the ribonucleoprotein (RNP) complex is exposed to the cell's machinery. Explain Phylogenetic Analysis and Adenovirus Vaccine Cloning and Rationalization of Rabies Virus.arrow_forwardThe diversity of nucleic acids in plant viruses is great. Which class of viruses contain single-stranded RNA? These viruses are the source of which important enzyme (Hint: THis is the enzyme needed to make cDNA)?arrow_forward
- RNA polymerase in Escherichia coli normally synthesizes all of the following molecules except: RNA primers during DNA replication messenger RNA (mRNA) transfer RNA (tRNA) ribosomal RNA (rRNA) heterogenous nuclear RNA (hnRNA)arrow_forwardjust answer question --- dont need explanationarrow_forwardName (Last, First): DNA An RNA polymerase attaches to the DNA and transcribes the DNA to mRNA Ribosone BIO 340 Activity # 1: DNA and the Central Dogma Complete: DNA Coding 5' ATG TGG ATT CTC AAG ATC AAT AGT 3' DNA template 3 5' Cytoplasm Nuckus Nuclear pore ARNA Use the mRNA codon sequence and the genelic Landelable in order to find the amino acid (AA) sequence of the protein. Example: if mRNA sequence is GUU then the corresponding amino acid 3-letter is Valine (Val) and the corresponding amino acid 1-letter is V. mRNA codon 5' FIRST (5') LETTER tRNA codon 3 U AA 3-letter AA 1-letter Amino acid AA - Amino acid A tRNA THE GENETIC CODE New protein being built U Pie (F) ասա UUC) ԼԱՔ Uva) Lou (L) Leu (L) val (M) Use numbers 1 to 3 to indicate the correct order of the flow of biological information. Translation Replication Transcription Hydroxyl group Deoxyribose sugar DNA's charge is negative due to following (circle the correct one): An alpha helix and a beta sheet in a protein are a type…arrow_forward
- Coronavirus from bats to animals, sequence comparison: Note: dots mean amino acid is the same as the one in the top sequence. Human Virus AGNNPLQTYVIACQDGGERRAAQDMFSAKKGGQTPAYWGC Civet Cat Virus G..... ......K....E.....R. .W. Pangolin Virus GA.Q....W..G....C.L..V.E....Q.. Bat Virus B Bat Virus AG .A.Q....W..G....C.L.. .....K. Y.. .N.G.T.A .2.. .N.G.T.A .R.......Y.. A researcher isolates a coronavirus from humans that they believe came from Bat virus A or Bat virus B. They also think the virus may have first gone through pangolins or civet cats. Shown above is an amino acid sequence comparison in the region of the virus spike protein that binds to the cell receptor. All viruses are compared to the human virus with colored dots indicating the same amino acid at that position and letters representing the amino acid change at the particular position. Answer the questions below using the figure. Question 1 (3 points). Does this data support the idea that the human virus is derived from a…arrow_forward*Has either 1 or 2 correct answers*arrow_forwardanswer all subpart to upvote because vert short question otherwise dislike Viruses that infect bacteria (bacteriophage) sometimes encode a lysozyme gene in their genome. The gene gets inserted into the bacterial genome and gets expressed in the same way that bacterial genes get expressed. A) What location in the bacterial cell would the gene get transcribed into mRNA? (1 sentence max) B) What protein complex would perform the transcription to produce the mRNA? (1 sentence max) C) Where in the bacterial cell would the gene get translated? (1 sentence max) D) What protein complex would perform the translation to produce the protein? (1 sentence max)arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage Learning
Biology: The Dynamic Science (MindTap Course List)BiologyISBN:9781305389892Author:Peter J. Russell, Paul E. Hertz, Beverly McMillanPublisher:Cengage Learning
Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
Biology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage Learning
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
Biology: The Dynamic Science (MindTap Course List)
Biology
ISBN:9781305389892
Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan
Publisher:Cengage Learning
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning