Biology: The Dynamic Science (MindTap Course List)
4th Edition
ISBN: 9781305389892
Author: Peter J. Russell, Paul E. Hertz, Beverly McMillan
Publisher: Cengage Learning
expand_more
expand_more
format_list_bulleted
Question
Chapter 19, Problem 13TYK
Summary Introduction
To review:
The best method used to distinguish the functioning gene from pseudogenes used for annotating protein-coding genes.
Introduction:
The complete sequence of the nitrogenous bases is important to determine because this will specify certain information, which it carries. The annotation is done to determine the function of the determined sequences.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
While comparative genomics is fundamentally the study of the differences between the genomes of species, it can also give clues about functional genomics (the study of the biological functions that rely on genomic sequences i.e. related sequences that encode the various proteins within a family). How? Give an example
Can Bioinformatics be used for sequence annotation to identifyprotein-coding and noncoding sequences of a gene ? If yes then explain how ?
Genome annotation refers to ...
1.) lining up overlapping regions in short shotgun sequencing reads to assemble
larger contiguous DNA sequences (contigs/scaffolds).
2.) using long-read sequencing platforms (such as PacBio or Oxford Nanopore) to gather information about the epigenetic status of each region of a sequenced genome.
3.) the process of predicting which parts of a genome sequence code for functional products (such as protein-coding genes), what those products do, and assigning them names.
4.) sequencing messengeRNA measure the relative expression levels of genes in
one or more tissue samples.
Chapter 19 Solutions
Biology: The Dynamic Science (MindTap Course List)
Ch. 19.1 - What additional biological questions can be...Ch. 19.2 - What is the principle behind whole-genome shotgun...Ch. 19.2 - Prob. 2SBCh. 19.2 - Prob. 3SBCh. 19.2 - Prob. 4SBCh. 19.3 - Prob. 1SBCh. 19.3 - Prob. 2SBCh. 19.3 - Prob. 3SBCh. 19.4 - Prob. 1SBCh. 19.4 - Prob. 2SB
Ch. 19 - Prob. 1TYKCh. 19 - How do pseudogenes differ from genes? a. They are...Ch. 19 - Prob. 3TYKCh. 19 - Prob. 4TYKCh. 19 - Prob. 5TYKCh. 19 - Prob. 6TYKCh. 19 - About 95% of the average human transcription unit...Ch. 19 - Prob. 8TYKCh. 19 - Prob. 9TYKCh. 19 - When two protein-coding genes have very similar...Ch. 19 - Prob. 11TYKCh. 19 - Prob. 12TYKCh. 19 - Prob. 13TYKCh. 19 - Discuss Concepts The genome of the yeast...Ch. 19 - Prob. 15TYKCh. 19 - Prob. 16TYKCh. 19 - Prob. 17TYKCh. 19 - Below is a sequence of 540 bases from a genome....
Knowledge Booster
Similar questions
- Suppose that you have just graduated from college and have started working at a biotechnology firm. Your first job assignment is to clone the pig gene for the hormone prolactin. Assume that the pig gene for prolactin has not yet been isolated, sequenced, or mapped; however, the mouse gene for prolactin has been cloned, and the amino acid sequence of mouse prolactin is known. Briefly explain two different strategies that you might use to find and clone the pig gene for prolactin.arrow_forwardHi, I would like to know which program is used for the graphical presentation of the results of a meta-analysis of genome-wide linkage scans?arrow_forwardWhat are site-recombinases? Describe in detail how cre- recombinase can be used to decipher the roles of specific genes and proteins in complex multicellular organisms? Explain how the cre-lox system can be used to examine the role of a particular gene in a specific type of tissue?arrow_forward
- Describe the following techniques for determining gene or protein function with advantages disadvantages and limitations. i)forward genetics(random mutagenesis) ii)reverse genetics(altering the function of particular gene) iii)genetic analysis(double or higher order mutant combination) iv) expression studies RNA and protein v)protein interaction studies(Y2H and other technique)arrow_forwardIn the practical you have been analysing a human genomic library. You know from your calculations that only a small proportion of the human genome is represented, even when the entire class results are considered. Therefore, the chance of finding a particular single-copy gene in your library is very small. Outline a strategy for constructing a genomic DNA library more representative of the entire human genome. You will need to consider alternative vectors and the efficiency of transformation of the bacterial cells.arrow_forwardAssume 2x108 reads of 75 bps long are obtained from a next-generation sequencing experiment to sequence a human genome. Suppose the length of the human genome is 3x109 bps. What is the depth (i.e., coverage) of the sequencing?arrow_forward
- Give a step by step method and diagram of how reversible terminator sequencing works.arrow_forwarda) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSParrow_forwardTranscriptome analysis involves two separate methodologies: gene expression and RNA seq analyses. The 10 items below are a scrambled listing of the steps used in the two procedures. Identify the steps involved in RNA seq from the list below. Use the numbers in the list to refer to each step. Once the steps for RNA seq have been identified, write the steps in the order in which they are performed during the experiment. (1) DNA sequencing (2) Allow for hybridization and wash excess cRNA. (3) Mix labeled cRNA with array chip. (4) PCR amplification (5) Measure fluorescence intensity to determine abundance of transcripts. (6) Add labeled cRNA at each microarray location. (7) Map cDNA sequences to the genome of the organism to determine identity and abundance of transcripts. (8) mRNA isolation from cells (9) Prepare fluorescently labeled cRNA probes (10) cDNA synthesisarrow_forward
- The technique of fluorescence in situ hybridization (FISH) is described. This is another method for examining sequence complexity within a genome. In this method, a DNA sequence, such as a particular gene sequence, can be detected within an intact chromosome by using a DNA probe that is complementary to the sequence.For example, let’s consider the β-globin gene, which isfound on human chromosome 11. A probe complementary to theβ-globin gene binds to that gene and shows up as a brightly colored spot on human chromosome 11. In this way, researchers can detectwhere the β-globin gene is located within a set of chromosomes. Becausethe β-globin gene is unique and because human cells are diploid(i.e., have two copies of each chromosome), a FISH experimentshows two bright spots per cell; the probe binds to each copy ofchromosome 11. What would you expect to see if you used thefollowing types of probes?A. A probe complementary to the Alu sequenceB. A probe complementary to a tandem array near…arrow_forwardSome synthetic biologists have proposed creating an entirely new, freeliving organism with a minimal genome, the smallest set of genes that allows for replication of the organism in a particular environment. This genome could be used to design and create, from “scratch,” novel organisms that might perform specific tasks, such as the breakdown of toxic materials in the environment. Q. How might the minimal genome required for life be determined?arrow_forwardLet’s suppose you are in charge of organizing and publicizing a databasefor the mouse genome. Make a list of innovative strategies you wouldinitiate to make the mouse genome database useful and effective.arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSON
Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
Anatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education