Campbell Biology In Focus, Loose-leaf Edition (3rd Edition)
3rd Edition
ISBN: 9780134895727
Author: Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Videos
Textbook Question
Chapter 17.2, Problem 2CC
MAKE CONNECTIONS The RNA virus in Figure 17.7 has a viral RNA polymerase that functions in step 3 of the virus’s replicative cycle. Compare this with a cellular RNA polymerase In terms of template and overall function (see Figure 14.10).
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
Draw a generic (+)RNA virus replication cycle. For viruses, (+) RNA indicates the genomic RNA can be translated directly. How would this differ from the system you drew in #1?
Draw a generic (+) RNA virus replication cycle. Indicate which proteins need to be present for RNA replication and translation. Where would they act?
Indicate what sequences or modifications would need to be present on the virus RNA for RNA replication and translation.
How might a virus differentiate between RNA to be put into progeny virus particles and RNA to be translated into protein?
Show your work please
Many virologists note that viruses which have a genome made up of RNA will tend to evolve faster than those viruses whose genome is made up of double-stranded DNA.
Most evolutionary biologists now accept that RNA was the first nucleic acid molecule to evolve to store information. Why is this early “RNA world” more likely when you consider how RNA polymerases (such as primase) and DNA polymerases start replicating nucleotide chains?
Chapter 17 Solutions
Campbell Biology In Focus, Loose-leaf Edition (3rd Edition)
Ch. 17.1 - Compare the structures of tobacco mosaic virus and...Ch. 17.1 - Prob. 2CCCh. 17.2 - Compare the effect on the host cell of a ly1ic...Ch. 17.2 - MAKE CONNECTIONS The RNA virus in Figure 17.7 has...Ch. 17.2 - Why is HIV called a retrovirus?Ch. 17.2 - MAKE CONNECTIONS Compare the CRISPR system to the...Ch. 17.3 - Describe two ways in which a preexisting virus...Ch. 17.3 - Contrast horizontal and vertical transmission of...Ch. 17.3 - Prob. 3CCCh. 17 - which of me following characteristics. structures....
Ch. 17 - Prob. 2TYUCh. 17 - A human pandemic is A. a viral disease that...Ch. 17 - Prob. 4TYUCh. 17 - RNA viruses require their own supply of certain...Ch. 17 - Prob. 6TYUCh. 17 - Prob. 7TYUCh. 17 - Prob. 8TYUCh. 17 - FOCUS ON ORGANIZATION While viruses are considered...Ch. 17 - SYNTHESIZE YOUR KNOWLEDGE Oseltamivir (Tamiflu),...
Additional Science Textbook Solutions
Find more solutions based on key concepts
True or false? Some trails are considered vestigial because they existed long ago.
Biological Science (6th Edition)
What is the pH range for acidic solutions? For basic solutions?
EBK INTRODUCTION TO CHEMISTRY
Single penny tossed 20 times and counting heads and tails: Probability (prediction): _______/20 heads ________/...
Laboratory Manual For Human Anatomy & Physiology
How does the removal of hydrogen atoms from nutrient molecules result in a loss of energy from the nutrient mol...
SEELEY'S ANATOMY+PHYSIOLOGY
An obese 55-year-old woman consults her physician about minor chest pains during exercise. Explain the physicia...
Biology: Life on Earth with Physiology (11th Edition)
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Q10. Does frame +2 have an ORF in the coding region of this exon? What about frame +1 and frame +3? Q11. Given that 3 of the 64 possible codons are stop codons, what is the chance of having a stop codon at any given position, assuming that the sequence is random?arrow_forwardCoronavirus from bats to animals, sequence comparison: Note: dots mean amino acid is the same as the one in the top sequence. Human Virus AGNNPLQTYVIACQDGGERRAAQDMFSAKKGGQTPAYWGC Civet Cat Virus G..... ......K....E.....R. .W. Pangolin Virus GA.Q....W..G....C.L..V.E....Q.. Bat Virus B Bat Virus AG .A.Q....W..G....C.L.. .....K. Y.. .N.G.T.A .2.. .N.G.T.A .R.......Y.. A researcher isolates a coronavirus from humans that they believe came from Bat virus A or Bat virus B. They also think the virus may have first gone through pangolins or civet cats. Shown above is an amino acid sequence comparison in the region of the virus spike protein that binds to the cell receptor. All viruses are compared to the human virus with colored dots indicating the same amino acid at that position and letters representing the amino acid change at the particular position. Answer the questions below using the figure. Question 1 (3 points). Does this data support the idea that the human virus is derived from a…arrow_forwardExplain the Gene Expression Experiment Re-Analysis Summary of Rabies Virus(Taxon:11292) Explain how The virus attaches to the cell membrane of the host cell via the G protein. How the virus penetrates the cytoplasm and the ribonucleoprotein (RNP) complex is exposed to the cell's machinery. Explain Phylogenetic Analysis and Adenovirus Vaccine Cloning and Rationalization of Rabies Virus.arrow_forward
- RNA polymerase in Escherichia coli normally synthesizes all of the following molecules except: RNA primers during DNA replication messenger RNA (mRNA) transfer RNA (tRNA) ribosomal RNA (rRNA) heterogenous nuclear RNA (hnRNA)arrow_forwardPlease help a bit confusedarrow_forwardLet's imagine you have discovered a new RNA virus and found a cell line to grow the viruses (lucky you!). Early experiments show virus' genome to be single-stranded RNA but you are unsure if it is positive or negative RNA. Explain how using anisomycin, an eukaryotic protein synthesis inhibitor, could potentially provide an answer.arrow_forward
- In Figure 8-5, draw the “one gene” at much higher resolution with the following components: DNA, RNA polymerase(s), RNA(s).arrow_forwardHow are poly-adenosine tails added to subgenomic mRNAs of RNA viruses? Repeated uracil bases on the template cause the polymerase to slip backwards and recopy the sequence Polymerases copy a 200 base string of uracils found in some RNA viral genomes Polymerases copy a 200 base string of uracils added to the template during circularization Viral mRNAs undergo post-translational modifications, which include splicing of introns, a 5'-cap, and a 3'-poly-A tailarrow_forwardFigure 15.16 Many antibiotics inhibit bacterial protein synthesis. For example, tetracycline blocks the A site on the bacterial ribosome, and chloramphenicol blocks peptidyl transfer. What specific effect would you expect each of these antibiotics to have on protein synthesis? Tetracycline would directly affect: tRNA binding to the ribosome ribosome assembly growth of the protein chain Chloramphenicol would directly affect tRNA binding to the ribosome ribosome assembly growth of the protein chainarrow_forward
- bioarrow_forwardReverse Transcription Black-viral genome IRNA (A) Green-tRNA from host R US PBS (-)ssDNA PPT U3 R (-) Strand Synthesis Red- minus strand DNA (B) Blue-plus strand DNA PPT First Strand Transfer RUS (C) U3R (-) Strand Synthesis PPT US R US (D) HIV ppt: PBS 5'-AAAAGAAAAGGGGGG-32 (-) & (+) Strand Synthesis (E) US R US (+) Strand Synthesis PPT PPT (F) U3 R US Second Strand Transfer U3 R US PBS - US PBS R US (+)ssDNA (G) US R US (H) LTR Strand displacement synthesis PPT PPT US R US LTR Basu et al., Virus Res. 2008, 134:19-38. Use the image above to answer the multiple choice question. If an infection with HIV is carried out with a virus that has a mutation that prevents reverse transcriptase from recognizing the polypurine tract (PPT), which of the following would be observed. No viral DNA would be observed Complete viral double strand DNA would be observed. Only a small piece of minus sense DNA would be observed. Nearly completed minus sense but no plus sense DNA would be observed. Nearly…arrow_forwardasap please A partially filled diagram of eukaryotic gene structure is shown below. Label the following additional elements in the empty boxes. One label must be used twice: a) 3'UTR, b) 5'UTR, c) exon, d) intron, e) promoterarrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Biology Today and Tomorrow without Physiology (Mi...BiologyISBN:9781305117396Author:Cecie Starr, Christine Evers, Lisa StarrPublisher:Cengage Learning
Biology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage Learning
Biology: The Dynamic Science (MindTap Course List)BiologyISBN:9781305389892Author:Peter J. Russell, Paul E. Hertz, Beverly McMillanPublisher:Cengage Learning
Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
Biology Today and Tomorrow without Physiology (Mi...
Biology
ISBN:9781305117396
Author:Cecie Starr, Christine Evers, Lisa Starr
Publisher:Cengage Learning
Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning
Biology: The Dynamic Science (MindTap Course List)
Biology
ISBN:9781305389892
Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan
Publisher:Cengage Learning
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
What is Genomics - Full Length; Author: Genome BC;https://www.youtube.com/watch?v=mmgIClg0Y1k;License: Standard youtube license