What is the difference between preproinsulin and proinsulin? B. What is cleaved out of proinsulin to allow the mature insulin molecule to be formed?  C. What is the C peptide and why is it medically significant? D. What is the purpose of the signal sequence and why isn’t it present in the mature insulin molecule?

Q: What would you expect to observe if you engineered a chimeric nuclear receptor superfamily protein…

A: This chimeric nuclear receptor information is important for scientists who are designing new drugs.…

Q: Define The LIS1 protein, whichregulates dynein, is required for brain development.

A: Lissencephaly is related to brain disorders, this disease leads to sporadic mutations in the gene…

Q: Explain, why many cancer cells maintain high concentrations of insulin-like growth factors (IGFs) in…

A: Cancer is basically the uncontrolled growth and division of cells without the death of the cells in…

Q: Suppose that, through genetic manipulations, a chimeric receptor is produced that consists of the…

A: A protein that shows binding affinity to a specific molecule is termed as a receptor protein. The…

Q: 2. Researchers have discovered significant changes in the gene of some protein, which is a substrate…

A: Insulin is an anabolic peptide hormone secreted by B-cells of the pancreas. It plays a major role in…

Q: In a rare genetic disorder, the absence of a particular enzyme leads to increasedtestosterone…

A: Aromatase is an enzyme, which is involved in the production of estrogen that acts by catalyzing the…

Q: 18. (04.01 HC) Biological recognition is important in processes at the molecular, cellular, and…

A: The objective of the question is to understand the role of cell membranes and their components in…

Q: a. A typical cellular response of a mammary epithelial cell to EGF signal is proliferation. the Kd…

A: Proliferation is the cellular response.

Q: How can bacteria producehuman insulin on an industrialscale? What are the otherforms of insulin…

A: Biotechnology deal with biological and biopharmaceuticals. Biotechnology applied in diagnostic,…

Q: Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG…

A: The polymerase chain reaction is a molecular technique responsible for exponentially amplifying a…

Q: Explain insulin's signal transduction pathways and trace the pathway of cell signaling from the cell…

A: Insulin is a peptide hormone that is secreted by the b cells in pancreas. It act through a receptor…

Q: Mature human insulin is synthesized from a single Gene but contains two polypeptide chains (A and B)…

A: Introduction Pancreas is a holocrine gland present in our body. It has both endocrine and exocrine…

Q: . Which observation suggested to Sutherland the involvementof a second messenger in epinephrine’s…

A: The adrenal medulla’s hormones, epinephrine (adrenaline) and norepinephrine (noradrenaline).…

Q: Explain how the hormone-receptor complex can alter theG proteins on the inner surface of the plasma…

A: Cellular signaling is the process, during which the cell respond to the extracellular environment…

Q: What is the cell found in tissues where the hormone produced leaves behind a C peptide during…

A: C-peptide is a peptide composed of 31 amino acids.

Q: Which of the following would result in an INCREASE in BLOOD glucose levels ? choose all of the…

A: Introduction :- Glucose is the final product of digestion of food , that we intake . After complete…

Q: 10. Proinsulin, stored in secretory vesicles in the B-cells of pancreatic islets, is converted to…

A: Proinsulin is a single chain pancreatic polypeptide precursor of the hormone insulin which results…

Q: 82. Regulation of cellular metabolism by insulin requires activation of the insulin-receptor…

A: A strong anabolic agent, insulin promotes nutrient uptake, storage, and synthesis within cells while…

Q: What is the purpose of having a sex hormone binding protein within the blood stream? What is the…

A: Hi! Thank you for your question. But as you have posted multiple questions and have not mentioned…

Q: What are the three main parts of a signaling pathway? Give a detailed specific example, such as how…

A: Cell signaling is part of the cellular communication process that regulates the basic activities of…

Q: B-If a cell capable of de novo synthesis of purine-based nucleotides and has excess amounts of AMP…

A: GMP and AMP are synthesized from the precursor IMP. Aspartate reacts with IMP and forms…

Q: In studies trying to understand the regulation of hormone-sensitive adenylate cyclase, it was…

A: Understanding the intricate regulation of hormone-sensitive adenylate cyclase is pivotal in…

Q: 32. During a study of insulin response, a healthy nonobese 24-year-old woman consumes four pancakes…

A: When subjected to a prolonged period of starvation, the level of glucose in the blood falls. This…

Q: Explain the relationship between the variable number of tandem repeats in the insulin promoter…

A: Autoimmune diabetes is also called type 1 diabetes mellitus. This type of diabetes mellitus is…

Q: EGF signals by binding to cell surface EGF receptors. Which of these observations, if true, would…

A: The epidermal growth factor receptor (EGFR) signaling pathway is one of the most important pathways…

Q: Lipodystrophy is a condition in which an individual lacks adipose tissue. The muscles and liver from…

A: A group of disorders of the body metabolism that develop life-threatening illnesses, such as heart…

Q: Epigenetics may be partially responsible for the childhood epidemic of obesity. Explain.

A: The study of how your behaviors and environment can cause changes that affect the working of your…

Q: The genetic code is redundant, unambiguous, and universal. - Which of these terms best explains why…

A: The genetic code is the set of rules by which information encoded in genetic material,…

Q: 32. Through our expertise in biochemical manipulation, we found a way to alter the G protein-coupled…

A: The g protein coupled receptor are the receptor which are present in the cell membrane and passes…

Q: "Schematic outline of melanogenesis. UVR stimulates the expression of POMC by keratinocytes. The…

A: Melanogenesis is the chemical pathway through which natural pigments known to be melanin pigments…

Q: What pathway in addition to the cAMP-induced signal transduction pathway is used in the liver to…

A: Glycogen breakdown occurs when the body is in need of glucose to produce energy in the form of ATP.…

Q: Thyroid peroxidase iodinates tyrosine residues within the thyroglobulin protein, and this enzymatic…

A: The gland located at the back of the neck is butterfly-shaped and is called the thyroid gland. The…

Q: Which of the following is correct? A. The gene CYP21A2 is the one that codes for the formation of…

A: Option 1 is incorrect as CYP21A2 is not associated with the code that helps formation of glucose-6…

Q: Discuss the family of nuclear hormone receptors and explain how ligand binding to such a receptor…

A: The structure of ligand receptor complex allows it to recruit co activators. When the ligand bind to…

Q: Need ANSWER ASAP with short explanation ...

A: Answer--

Q: A fixed amount of radiolabelled insulin was incubated with a fixed amount of anti-insulin antibody,…

A:

Q: Suppose a researcher discovers a new growth-factor signal-transduction pathway. When the researcher…

A: G-Protein Coupled Receptors (GPCRs) are the most common transmembrane receptor in humans. It is…

Q: a. Name the phosphoinositide generated through the action of PI-5 kinase. b. Name the products…

A: Phosphatidylinositol (PI)- related signalling is significant for endurance, cell multiplication,…

Q: Describe the events required for full activation of protein kinase B. Name two effects of insulin…

A: Protein kinase B (PKB) is also used to define as a way to refer to as Akt. It is a…