The genes A and B are on the same chromosome and 24 map units away from each other. Consider an individual with genotype Ab/aB. What is the probability that this individual's gamete has genotype aB? A) 6% B) 12% C) 24% D) 38% E) 48%

Q: Y ~ U(0, 1) be independent random variables un ind the LMMSE estimator of X given Z. ind the MMSE…

A: Introduction:- We would like to estimate the value of an unobserved random variable X, given that we…

Q: Distinguish between the variables q and q2 in the Hardy-Weinberg equation.

A: Introduction  Hardy Weinberg equilibrium: this states that the sum of genotypic and allelic…

Q: what is the meaning of "You cannot get order and complexity from random chaos alone"

A: Evolution is caused by changes in the heritable characteristics of the biological population over a…

Q: Match the following formulas with their correct descriptions form the drop down menu provided.…

A: Population dynamics is a fundamental concept in ecology and biology that involves studying the…

Q: In the 1960s, the drug thalidomide was prescribed to pregnant women to treat morning sickness.…

A: STEREOISOMERS THE COMPOUND WHICH HAVE SAME MOLECULAR FORMULA BUT ARRANGEMENT OF BONDS ARE DIFFERENT…

Q: a. d(pAACGTCTC) b. pGUAACUGC

A: Oligonucleotides are the short DNA or Rna molecules known as oligomers.

Q: What information do the mean and variance provide about a distribution?

A: Statistical methods are of great importance in biology as they help in analysis and inference of an…

Q: Which of the following are variable terms in the discrete-time logistic model? ΔN Δt rmax,d t…

A: Variable: the value which is changed during simulation. Any value that can be changed over time is…

Q: If a set of WFFS has no truth-value assignment, or truth-table row, wherein all WFFS are true at the…

A: According to question If a set of WFFs has no truth-value assignment, or truth-table row, wherein…

Q: _1. I. The skin, lungs, and kidneys are specialized to excrete wastes. II. Guard cells control the…

A:

Q: MAP= CO x TPR / 80  I don't understand the value of TPR how do I get this number?

A: Mean arterial pressure is the the average blood pressure in an individual during one cardiac cycle.…

Q: Assume that a Chi-square test was conducted to test the goodness of fit to a 3:1 ratio and that a…

A: Chi square test is used to determine whether a genotypic ratio committed monohybrid Bor dihybrid…

Q: In the disease familial hypercholesterolemia (inherited tendency for high blood LDL cholesterol…

A: Familial hypercholesterolemia (FH) is a hereditary condition characterised by elevated blood levels…

Q: Use the following DNA sequence, and write the resulting messenger RNA sequence

A: When DNA makes it's two copies then this is called replication. When DNA is converted into RNA then…

Q: Please provide a chromatography technique to isolate the protein A from the mixture containing…

A: Chromatography is the technique used for the separation of molecules or analytes from the mixture by…

Q: Using the amino acid sequences in Cytochrome C provided in the following table, list the amino acid…

A: Amino acid position Amino acid in human Amino acid in chicken 2. Glutamic acid Proline 3.…

Q: Three polypeptides, the sequences of which are represented below using the one-letter code for their…

A: In peptide 1, - (ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG) Total number of negatively charged…

Q: Is there a reason why you divided the pKa's by 2 when determining the pI?

A: Isoelectric pH or pI is the pH at which the amino acid or the peptide is in zwitterion state.…

Q: dichotomous key?  Why does the term “dichotomous” let you know that? (hint: look up the Greek roots…

A: In phylogenetics, a single-access key (also called dichotomous key, sequential key, analytical key,…

Q: Which of the phi/psi angles would be violating a ramachandran plot? Select all that apply: Phi= 90;…

A: The Ramachandran plot is a plot of the torsional angles - phi (φ)and psi (ψ) - of the residues…

Q: 1. How can you tell which data is an independent variable? Dependent variable? 2. What kind of data…

A: Introduction:- Independent variable is a stand-alone variable that isn't affected by the other…

Q: So does that mean all answers are correct?

A: Homologous recombination A kind of genetic recombination called homologous recombination involves…

Q: What does the “=“ mean when used in a macromolecule when written out.

A: Chemical bonds are formed due to the attractions that form linkages between ions, atoms, and/or…

Q: A jar contains 4 red marbles numbered 1 to 4 and 10 blue marbles numbered 1 to 10. A marble is drawn…

A: The probability of an event is measured as the chance of a desirable event occurring out of the…

Mitochondrial Mutations

A mitochondrion is a cellular organelle that serves as the site for cellular respiration and energy production (ATP or Adenosine Triphosphate). It is a double-membrane-bound organelle and is only present in eukaryotic cells.