Monomeric, single-pass transmembrane proteins span a membrane with a single a helix that has characteristic chemical properties in the region of the bilayer. Which of the three 20-amino-acid sequences listed below is the most likely candidate for such a transmembrane segment? O ITLIYFGVMAGVIGTILLIS O ITPIYFGPMAGVIGTPLLIS O ITEIYFGRMAGVIGTDLLIS

Monomeric, single-pass transmembrane proteins span a membrane with a single a helix that has characteristic chemical properties in the region of the bilayer. Which of the three 20-amino-acid sequences listed below is the most likely candidate for such a transmembrane segment? O ITLIYFGVMAGVIGTILLIS O ITPIYFGPMAGVIGTPLLIS O ITEIYFGRMAGVIGTDLLIS

Biology: The Dynamic Science (MindTap Course List)

4th Edition

ISBN:9781305389892

Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Publisher:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Chapter19: Genomes And Proteomes

Section: Chapter Questions

Problem 1ITD: Below is a sequence of 540 bases from a genome. What information would you use to find the...

See similar textbooks

Related questions

Q: Two peptide segments are shown below. Predict which one would have the most negative AG when going…

A: Protein folding is a spontaneous reaction by which most of the proteins fold inside the cell without…

Q: A peptide has the following amino acid composition: 2 Met, 2 Phe, 2 Glu, 1 Arg, 1 Lys, 1 Val, 1 Leu,…

A: Small molecules called amino acids form the building blocks of proteins. In chemistry, an amino acid…

Q: The domain of a protien is approximately 350 residues in length. what is length (in A°) of this…

A: Proteins or peptides are the linear chains of amino acid sequences attached via peptide bonds. The…

Q: Hair is comprised largely of keratin, a fibrous protein consisting of two a-helices wrapped around…

A: Amino acids are biomolecules that have an amino group and a carboxyl group linked to the same carbon…

Q: The given protein, Protein X, is a heterotrimer - meaning it is a multimeric protein consisting of…

A: PAGE stands for Polyacrylamide Gel Electrophoresis. PAGE method is influenced by the molecular…

Q: Given the following sequence, what secondary structure does it most likely prefer, and where in a…

A: The amino acids are the smallest subunit or monomer of the proteins. These amino acids are…

Q: The genetic information contained in DNA consists of a linear sequence of coding units known as…

A: From the given case, it is known that the E. coli DNA has a size of 4.70 X 106 bps. As, it is given…

Question

Monomeric, single-pass transmembrane proteins span a membrane with a single a helix that has characteristic chemical properties in the region of the bilayer. Which of the
three 20-amino-acid sequences listed below is the most likely candidate for such a transmembrane segment?
O TLIYFGVMAGVIGTILLIS
O ITPIYFGPMAGVIGTPLLIS
ITEIYFGRMAGVIGTDLLIS

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step 3

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 3 steps

SEE SOLUTION Check out a sample Q&A here

Similar questions

(a) Draw diagrams to show how the four synthetic oligonucleotides below could base-pair to form a stable model Holliday junction. W 5' GATCGCATTGTAGCCGTAGGTCCACTGTAA 3’ X 5' GTCCCATACGTAGCCGTAGGACATGTACCG 3' Y 5' CGGTACATGTCCTACGGCTACAATGCGATC 3' Z 5' TTACAGTGGACCTACGGCTACGTATGGGAC 3' I and 21
PfCRT is found to have 10 peaks on a hydropathy plot given its primary sequence. Researchers also noted that each peak is comprised of about 30 amino acids. The digestive vacuole membrane is 45Å in Plasmodium species. Explain why researchers conclude there are 10 transmembrane helices from these two pieces of data.
a and b please
A recent genome sequencing project for the bacterium Burkholderia mallei has identified a new protein with high similarity to the lysylphosphatidylglycerol flippase enzyme. A short section of the new protein sequence is shown below. TVEVNAPGDVQKALSELQQINDGRLDIRI (a) Are any reverse turns likely to be present? Explain your answer. (b) Are any beta-strands likely to be present? Explain your answer. (c) Are any alpha helices likely to be present? Explain your answer. (d) Is any supersecondary structure likely to be present? Explain your answer. (e) Identify two residues that are likely to be buried in the core of the folded protein. Explain your answer. (f) Identify two residues that are likely to be hydrogen bonded to each other. Explain your answer.
For transmembrane proteins, either single-pass or multi-pass, the membrane spanning part of the protein usually assumes which of the following motifs? βαβ αβα α-helix β-pleated sheet
SYNZIPS are a-helices that can be used in synthetic biology to create coiled-coil interactions between two different proteins. SYNZIP1 is around 47 amino acids in length. If each turn in an a-helix is 3.6 residues in length and each turn is 5.4 Å in length, how long is SYNZIP1? Keep in mind that 1 Å = 10 nm. Present your answer in nm.
Alpha-helices have 3.6 amino acid residues per turn, ie a helix 36 amino acids long would form 10 turns, and The axial distance between adjacent residues is 3.5 Angstroms. Beta-helices have two residues per repeat unit which gives the beta-strand a 7 Angstrom pitch. This compares with the alpha-helix where the axial distance between adjacent residues is only 1.5 Angstroms. Then how many residues in an alpha-helix conformation would it take to traverse the same distance as 10 residues in beta-strand conformation?
Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?
I’m not sure which answer is correct for this question can you please help?
Consider the following in light of the concept of levels of structure (primary, secondary, tertiary, quaternary)as defined for proteins.(a) What level is shown by double-stranded DNA?(b) What level is shown by tRNA?(c) What level is shown by mRNA?
The genetic information contained in DNA consists of a linear sequence of coding units known as codons. Each codon consists of three adjacent DNA nucleotides that corresponto a single amino acid in a protien. The E.coli DNA molecule contains 4.70 x 10^6 base pairs. Determine the number of codons that can be present. Assuming that the average protein in E.coli consists of a chain of 400 amino acids, calculate the maximum number of protiens that can be coded by an E.coli DNA molecule.
Based on sequences A,B,C. Provide an anticodon sequence that would build this protein. Sequence ATCTTCCCTCCTAAACGTTCAACCGGTTCTTAATCCGCCGCCAGGGCCCCGCCCCTCAGAAGTTGGTSequence BTCAGACGTTTTTGCCCCGTAACAACTTGTTACAACATGGTCATAAACGTCAGAGATGGTCAATCTCTTAATGACTSequence CTACAAACATGTAAACACACCCTCAGTGGACCAACTCCGCAACATAAACCAAACACCGCTCGCGCCGAAAAAGATATGG