Explaining Vapor Pressure in Terms of IMFs Given the shown structural formulas for these four compounds, explain their relative vapor pressures in terms of types and extents of IMFs: ОН 1 H₂C-CH₂ thandl HO OH || H₂C-CH₂ ethylene glycol CH3-CH₂-0-CH₂-CH3 and H-O-H diethyl ether water

Q: Question 11 Not yet answered Marked out of 1.00 P Flag question Which of the following are…

A:

Q: This is the structure of glucose-6-phosphate. What are the configurations at C1 and C2 respectively?…

A:

Q: Explain Separation of an isomeric mixture?

A: Isomers: Isomers are compounds having same molecular formula but different structural and Optical…

Q: Refer to the bar graph below, Explain why e.g. the n→π* interactions contribute more to the overall…

A: Proteins are complex molecules that are made up of long chains of amino acid residues. A linear…

Q: The molecule PF3 is polar. Select the IMF(s) that it can participate in.

A: Intermolecular forces present in PF3

Q: Explain the process of Calculating Enantiomeric Excess ?

A: The absolute difference between the mole fraction of two enantiomers is termed as enantiomers.

Q: Amino acids can be synthesized by reductive amination. Draw the structure of the organic compound…

A: In a reductive amination reaction, carbonyl compound reacts with ammonia or amine to form an imine…

Q: what is the full structure of CH3COCH2CO2OCH2CHO.    Please type answer note write by hend.

A: Given- Formula of    CH3COCH2CO2OCH2CHO.We need to write the   full structure of CH3COCH2CO2OCH2CHO.

Q: Given the Ka values (in parentheses) for the following acids: HSO4– (Ka= 1.2 x 10–2); HNO2 (Ka= 4.0…

A: Given data, Ka for HSO4- = 1.2 x 10-2 Ka for HNO2 = 4.0 x 10-4 Ka for HC2H3O2 = 1.8 x 10-5

Q: Refer to the buret shown below. When recording this measurement for the volume of water, how many…

A: The significant figures are calculated as shown below, Read the volume to 1/10 or 0.1 of the…

Q: In the box below draw the tetrahedral representation of the R enantiomer of the amino acid cysteine,…

A: R enantiomer of cysteine is

Q: 3. Draw the structure of the cross-link expected between a tyrosine side chain and the sulfonated…

A: The reaction between Tyrosine side chain and the sulfonated diazonium ion occurs in presence of…

Q: PCl5 is known but PI5 is not known Why?

A: ANSWER

Q: h. | ... Ph3P OCH 3

A: An arrow always depicts from a region of high electron density to low electron density ; that is…

Q: WS-3.8: Draw the Newman projection/s for 3-aminobutan-2-ol, looking down the C2-C3 bond where there…

A: In the molecules are observed along the connection connecting the main carbon atoms, shown as…

Q: 8. The following proteins represent a wide range of molecular weights and isoelectric points. Mr is…

A:

Q: a. Explain why the presence of certain proteins in body fluids such as urine or blood can indicate…

A: a. A group of amino acids combining together to form various molecules are called proteins. They are…

Q: 4. a) Choose the species from the list that would form the strongest interaction with OH". Cut O…

A: Hydroxide ion donates electron pair with the given cations. The interaction between the OH- and the…

Q: e box below draw the tetrahedral representation of the S enantiomer of the amino acid valine,…

A:

Q: Explain why compounds of Zn2+ are white, but compounds ofCu2+ are often blue or green?

A: Zn2+ has the electronic configuration of [Ar] 3d10 with all the electrons paired in the d-orbitals.…

Q: Biotin has a single ionizable group with a pKa of 4.5. If you dissolved biotin in an aqueous…

A: The question is based on the concept of biomolecules. We have to account for the dissociation…

Q: ART A-Table 1 Soln (Flask) No. Vol of NaSCN Soln (mL) Initial [SCN-] Eqm [FeSCN2+] Absorbance…

A: According to Beer's law, the absorbance for any solution is directly proportional to its initial…

Q: 6. How are fhese selated: (25,3R) 2 bromo 3chloro butane (25,35) 2bromo 3ch loro butane

A:

Q: In the box below draw the tetrahedral representation of the R enantiomer of the amino acid valine,…

A: Valine is amino acid,  consisting of one chiral center.   - Carbon to which both the amino and…

Q: The following sequence is part of a globular protein. Predict the secondarystructure in this region.…

A: There are two secondary structures: 1. Alpha Helix 2. Beta sheets RRPVVLMAACLRPVVFITYGDGGTYYHWYH…

Q: Shown below is the amino acid tyrosine in its protonated state, with the pk of each ionizable proton…

A:

Q: What is the impact of molecular chirality on the pharmacological activity of drugs, and how can it…

A: Introduction:The impact of molecular chirality on the pharmacological activity of drugs is a…

Q: Atmospheric Carbon dioxide is increasing. What effect does this have on coccolithophores and why?…

A: A question based on inorganic carbon cycle, which is to be accomplished.

Q: 1. It is observed that as temperature is increased, most protein molecules go from their defined,…

A: Each protiens have an optimum temparature for exixtence and activity. A noticeble decrease or…

Q: For an enzyme to catalyze a reaction, it must preferentially stabilize the transition state (TS) of…

A: A question based on enzyme catalysis reaction. A statement question about reaction coordinate in…

Q: Draw the zwitterion formula for the amino acid Ile. • You do not have to consider stereochemistry.…

A: The given amino acid is Isoleucin (Ile). The structure of Isoleucin is,

Q: For an aqueous solution of H3PO4, it was found that Ka1 > Ka2 > Ka3. What is a reasonable…

A: H3PO4(aq) = H+(aq) + H2PO4-(aq) H2PO4-(aq) =H+(aq) + HPO42- (aq) HPO42- (aq)= H+(aq) + PO43- (aq)

Q: Describe two examples of protein folding patterns and identify what level of protein structure they…

A: 1. Two examples of protein folding pattern is tertiary structure and quartenary structure. Tertiary…

Q: The use of salt bridges or hydrophobic interactions (or pockets) to stabilize interactions between…

A: Proteins are chain of polypeptide, and tertiary structure of protein is three-dimensional structure…

Q: a. Cu(s) b. [Cu(H₂O)]2+ (aq) c. Cu(OH)2(s) d. CuO(s)

A: The objective of the question is to identify the substances in which copper is an ion or an atom.

Q: Consider the formation of a dimeric protein 2P  ->P2   At 25.0 °C , the enthalpy of the reaction…

A:

Q: b CI C a Chiral center a is [ Select ] Chiral center b is [ Select ] Chiral center c is [ Select ]…

A:

Q: mino acid pKal pKa2 pKa3 Glycine 2.34 9.60 Aspartic acid 1.88 9.60 3.65 Glutamic acid 2.19 9.67 4.25…

A: The question is based on the concept of amino acids. we have to draw the structure of  tripeptide…

Q: What are the three dimensional structures of (R) - 2-aminopentane and (S) - 2-aminopropanoic acid…

A: In most of the carbon compound, carbon is sp3 hybridised. The sp3 carbon atom is a non plannar atom…

Q: Match the following amino acids with their chemical properties - VA - VB с D A VG O || H CH CH3 CH3…

A: Amino acids contain both amine and carboxylic acid functional groups.. In alpha amino acids the…

Q: draw the structure of EDPTK in its predominant form as it would exist at pH 5

A:

Q: A1c Select ONE peptide linkage and draw a circle around all of the atoms that would lie in a single…

A:

Solutions

Solutions can be considered as homogeneous mixtures which contain two or more than two chemical substances. The chemical substance which is the greater part is defined as solvent. And the chemical substance that is dissolved in a solvent is referred to as solute. Solution chemistry plays an important role in chemistry since it supports many commercial applications of solutions.