Explain the Titration Curve of Lysine in figure 1. Figure 1. Titration Curve of Lysine6.00 + 9.17pl == 7.59212108pl = 7.59pKa3 = 9.17pH} buffering regionpKa2= 6.00} buffering regionpKa1 = 1.821.02.03.04.0Moles OH per mole amino acidSelect AllAdcTitration Curve for Histidine4-2.14

The given figure in the question is titration curve of Histidine. Titration is the basic process…

Answered: Explain the Titration Curve of Lysine

Science

Biochemistry

Explain the Titration Curve of Lysine

Biochemistry

9th Edition

ISBN:9781319114671

Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Chapter1: Biochemistry: An Evolving Science

Section: Chapter Questions

Problem 1P

See similar textbooks

Related questions

Q: What are the steps of ATP synthesis during rotation of the a3ß3 hexamer? Include which steps…

A: The organic compound adenosine triphosphate (ATP) is a hydrotrope that provides energy to many…

Q: What is thee tRNA anticodon for the first 5’-ACGAUC-3’?

Q: Can you please help me how to draw tripeptide ile-leu-arg and indicate the torsion angles phi and…

A: Amino acids are organic acids that contain both carboxylic acid group as well as amine groups. The…

Q: 1. List the mRNA base codons for the amino acids listed below. 2. a) aspartate: b) lysine c)…

A: mRNA base codons are sequences of three nucleotide bases (adenine, guanine, cytosine, or uracil) in…

Q: Give the exact location of aminon.

A: Amnion is a type of membrane that surrounds the embryo and works as a shock absorbent to protect the…

Q: Write the structure formula, three-letter and one-letter abbreviation for each essential amino acid…

A: Amino acids contain amino group and carboxyl group along with R side chain. The R side chain defines…

Q: "The elasticity of elastin derives from its high content of a helices, which act as molecular…

A: Elastin is a protein. It is a component of the extracellular matrix in various tissues and organs.It…

Q: Lactose permease, a protein of E. coli, is composed of a singlepolypeptide that is 417 amino acids…

A: Translation is the process by which the protein is synthesized by reading the codons in mRNA. The…

Q: Write the one letter code for the oligopeptide Ser-Cys-Ile-Glu-Asn-Cys-Glu and calculate the total…

A: On a logarithmic scale from 0 to 14, pH, or "potential of hydrogen," measures the acidity or…

Q: Which peptide would absorb the most UV light at 280nm? (Can you show work because I mainly want to…

A: Aromatic amino acids are relatively non polar. All aromatic amino acids such as tyrosine,…

Q: Which form of flavin adenine dinucleotide is the "reduced" form, FAD or FADH2? Explain

A: Flavin Adenine Dinucleotide: It is a redox active coenzyme associated with various proteins, which…

Q: Identify the polar amino acids, the aromatic amino acids,and the sulfur-containing amino acids,…

A: The amino acids are the organic acids that contain alpha carboxyl group, alpha amino group, hydrogen…

Q: Lactose permease, a protein of E. coli, is composed of a single polypeptide that is 417 amino acids…

A: Lactose permease Its belong to transmembrane protein family. The transport mechanism of lactose…

Q: Consider a mutation that results in a substitution of Cysteine (CYS) ) for Tyrosine (TYR) at…

A: Cysteine is a polar amino acid. Cysteine is a triprotic acid with three ionizable functional…

Q: Draw and label the following RNA tetranucleotide: 5’phosphoryl-A-2’O-methyl-C-U-G-3’-phosphate

A: DNA (deoxyribonucleic acid) and RNA (ribonucleic acid) are polynucleotides, i.e., they are polymers…

Q: Use the following DNA sequence, and write the resulting messenger RNA sequence

A: When DNA makes it's two copies then this is called replication. When DNA is converted into RNA then…

Q: The SARS-CoV-2 spike protein is heavily glycosylated. What are some of the monosaccharides found in…

A: The spike (S) protein of SARS-CoV-2 mediates the virus binding to the human cells via its…

Q: Draw the structure of Arg - Lys - Ser - Trp at ph 7.4

A: The proteins are biological macromolecules that are composed of twenty naturally occurring amino…

Q: The neighboring amino acid that TYR 368 interacts with is ILE 160. What are the properties of the…

A: Amino acids are natural mixes that contain amine and carboxyl functional groups, alongside a side…

Question

Explain the Titration Curve of Lysine in figure 1.

Figure 1. Titration Curve of Lysine
6.00 + 9.17
pl =
= 7.59
2
12
10
8
pl = 7.59
pKa3 = 9.17
pH
} buffering region
pKa2= 6.00
} buffering region
pKa1 = 1.82
1.0
2.0
3.0
4.0
Moles OH per mole amino acid
Select All
Adc
Titration Curve for Histidine
4-
2.
14

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 2 steps with 2 images

SEE SOLUTION Check out a sample Q&A here

Similar questions

What is the 1-letter code for the amino acid glutamine? N E Q G
Enumerate all the possible DNA nucleotide base sequence for the amino acids given.
Why do both thymine and uracil specify the incorporation of adenine?
(b) Hemoglobin is made of B-globin subunits. The first few mRNA nucleotides for B- globin are given by: (1) (iii) (iv) Write down the DNA sequence that has led to this mRNA and indicate the sense and non-sense strands and the polarity. CE Derive the polypeptide for the sequence using the table of the genetic code (Table Q1 below) and indicate the polarity of the polypeptide chain. First Position (5' end) U A single point mutation in mRNA sequence can cause sickle cell anemia by changing the amino acid Glu to Val. For the given mRNA, indicate the point mutations for the first Glu in the polypeptide sequence that can cause this disease. 5'-AUGGUCCACCUGACUCCUGAGGAGAAG...UGA-3' C The polypeptide of B-globin contains the amino acid Leu. Write down all the anticodons of the tRNA molecules that can potentially code for Val. Indicate the polarity of the anti-codon. A G Table 1. The Codons of the Genetic Code Second Position U Phe Phe Leu Leu Leu Leu Leu Leu Ile Ile Ile Met-Start Val Val Val…
Based on the N-terminal amino acid sequence, what is the approximate half-life of the protein after methionine is cleaved off?
Write a DNA sequence that would encode the amino acid sequence valyl-tryptophanyl-lysyl-prolyl-phenylalanyl-threonine.
1 2 Glycogenin is a homodimer of 37 kDa subunits. (Homodimer means identical subunits of type a that form a dimer of type a2). Glycogenin has a chain of a(1,4)-linked units of glucose attached to the sidechain of a tyrosine residue. The chain of a(1,4)-linked glucose units is a primer for the initiation of glycogen synthesis by glycogen synthase. Assume the dimer is stable and not in equilibrium with monomer subunits. Which of the answers below are plausible pathways for attaching or building the primer chain of glucose units? The branching enzyme attaches a chain of 7 glucose units to the tyrosine sidechain of glycogenin. 0 0 0 0 000 The transferase attaches 3 units of a(1,4)-linked glucose to the tyrosine sidechain of glycogenin. Glycogen synthase then extends the chain using UDP-Glc. 0 One glycogenin dimer builds the a(1,4)-llinked glucose chain on a subunit of another glycogenin dimer. -D-O Each subunit builds the a(1,4)-Ilinked glucose chain on the other subunit of the same dimer.…
Draw the structural formula of the oligopeptide if the amino acids are arginine, glutamine, glycine, methionine and glutamic acid considering the first amino acid is the N-terminus
Draw the tetrapeptide Met-Ile-Lys-Glu at a ph of 7?
Bovine insulin is composed of two polypeptide chains that are linked together covalently. The two chains have the following sequences: GIVEQCCASVCSLYQLENYCN - A chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA - B chain a. Through which amino acids are these two chains linked together covalently? b. How many different ways can these two chains be linked? c. Of the different connectivities you enumerated in part b, which is the biologically active form?
Explain the reason why most proteins have less D-aspartate and elastin has increasing levels of D aspartate steadily with age.
What fragments can be generated in the decapeptide Gly-Lys-Ala-Met-Gly-Gly-Phe-Tyr-Trp-Ala if is subjected to: (a) trypsin, (b) chymotrypsin, and (c) cyanogen bromide.