0.35 0.3 0.25 0.2 0.15 0.1 0.05 0.1 0.2 0.3 0.4
Q: The top note in an essential oils blend has a _____ molecular weight and a _____ evaporation rate.…
A: Essential oils are natural oils with characteristic aroma of the plant and plant parts it is…
Q: I want more information about Advantages and disadvantages of bio energy And more examples it used…
A: Energy obtained from any biological source or biomass is called bioenergy or biomass energy. Biomass…
Q: In the supermarket why do they their produce with water on a regular basis?
A: Hi, Thanks For Your Question. Answer : The Reason Behind This Is To Maximize Profit. It Also Makes…
Q: This pathway is a net producer of energy. O True False
A: The Urea Cycle is a biochemical cycle that results in the production of Urea from Ammonia. The…
Q: The nitrogenous waste that requires the least energy to produce is O A. ammonia. OB carbon dioxide.…
A: Nitrogenous waste is produced by all living things and has to be disposed of out of the body.…
Q: alted fish producers receive complaints about poor quality from customers, the fish does not seem to…
A: There are four main fish preservation methods : Freezing Canning Smoking Pickling
Q: Explain the role of the following enzymes in feed industry: (a) Phytase (b) Tannase (c) Amylase
A: Enzymes are defined as the protein molecules that act as the biocatalyst in the living organism…
Q: Can you please answer this question
A: Green plants synthesis their own food and that is why they are called autotrophs. The process by…
Q: List any 2 mycotoxins and their effects on the food industry
A: Mycotoxins are generally toxic compounds that are produced by the fungus mainly. The mycotoxins are…
Q: How can you reduce the risks to the environment due to pumped hydroelectric and batteries
A: Hydroelectric is the renewable source of energy which can be renewed. It generates power or…
Q: Describe 3 factors that could inhibit primary production. Use examples to explain how autotrophs can…
A: Green plants are the autotrophs and use solar energy to produce organic food. They are the primary…
Q: Give 5 plants being used as a source of natural dyes having a distinct characteristic color and…
A: Plants are very important to humans. They provides lots of things such as vegetables, fruits and…
Q: Which is/are considered as gaseous waste products in plants? I. Oxygen II. Carbon dioxide III. Water…
A: Photosynthesis is a process in which plants utilize solar energy, carbon dioxide, and water to…
Q: Autotrophs are examples of consumers O True O False
A: Organisms can be classified based on how they obtain their nutrition and energy .
Q: Imagine a company producing Non-Biodegradable plastic which is polluting the local environment. 1.…
A:
Q: Create a bar graph to demonstrate the zones of inhibition for each antibiotic. Use the data from the…
A: Zone of inhibition is the area around antibiotic pot where it inhibits the growth of bacteria. The…
Q: Older people have a higher concentration of PFOAs bio-accumulate. Explain why bioaccumulation is…
A: PFOAs is a pollutant.
Q: elect all that are correct. The minimum inhibitory concentration a. can be determined by a…
A: When a new antibiotic is isolated, it needs to be studied in detail to know if it can be effective…
Q: The harvested carrots stored under 30°C (room temperature) changes it weights every day. Why? How to…
A: This question is about storage of food.
Q: I am having trouble creating one single graph for all this data. I need four lines. How could I…
A: 5 10 15 20 25 30 35 40 45 50 55 60 pH 2 0 0 0.2 0.3 0.3 0.3 0.4 0.4 0.5 0.5 0.6 0.7 pH 4 0 0…
Q: Stellvester Ajero is a farmer who raises deer in his ranch. He has 100 female deer age 3–15 months.…
A: As given, the deer require 22 MJ of metabolizable energy per day during the spring months.
Q: The enzyme that is released when raw potato is ground up is It acts upon producing and
A: Enzyme A protein molecule that help in metabolic reaction in organisms.
Q: The enzyme that is released when raw potato is ground up is ____________. It acts upon…
A: Enzymes are biocatalysts that enhance the rate of a chemical reaction without changing itself in the…
Q: It is estimated that 80-90% of the total metabolic activity in the soil can be attributed to what…
A: Soil serves as the home for several different invertebrate animals, such as worms, snails and upto…
Q: What is the definition of volatilization? Justify two practices that might help to reduce…
A: An ecosystem is essential to all life. Ecosystems rely on all of their elements to function…
Q: Enumerate any two biomaterial that are common or frequently encountered by many. Briefly explain the…
A: Biomaterials play an major role in modern medicine in contemporary times.
Q: What factors make for an effective biological control strategy of pest management? What risks are…
A: Biotechnology is a branch of biology that utilizes biological systems that is living organisms such…
Q: The ADP/ATP and NAD+/NADH ratios are key indicators of the energy status of cells a. True b. False
A: Adenine triphosphate (ATP) is an unstable molecule that when in equilibrium with water, hydrolyzes…
Q: There is a lot of green plant waste in your date farm. How will you convert this waste into a useful…
A: India is a quickly growing country and this created pressure on its natural resources. throughout…
Q: One difference between synport and antiport is that A. only antiport requires energy. B. only…
A: Symport and antiport are different types pf transporter protein.
Q: 40. Equation(s) producers, and equation(s) performed by consumers. a. I; II b. II; I c. I and II; I…
A: Equation (I) represents the process of photosynthesis where simple inorganic compounds like water…
Q: The harvested carrots stored under 30oC (room temperature) change it weights everyday. Why? How to…
A: Introduction: Although saving seeds from one season to the next is the main goal of preserving…
Q: is/are performed by consumers, and equation(s) is/are performed by producers. a. I; II b. II; I c. I…
A: All organisms on earth require input of energy from its environment. we know that son is the source…
Q: is/are performed by 2. Equation(s) consumers, and equation(s) is/are performed by producers. a. I,…
A: Introduction: All organisms on earth require input of energy from its environment. we know that…
Q: this resource can be replaced by natraul process and will never run out
A: There are two types of natural resources - 1. Non-renewable resources - Those resources that cannot…
Q: What is one of the main aspects of design for Enhanced Biological Phosphorus Removal (EBPR)? a)…
A: EBPR is a sewage treatment method that is used to remove phosphate from sludge (activated).
Q: What are Coal Power and Renewable Energy? Which type of energy is more polluting? Why are we still…
A: Note: As per the guidelines I am answering the first 3 questions. Repost all other remaining…
Q: n Eutrophication, excess nutrients can cause algal blooms. However, what happens when the algae…
A: Eutrophication is the process of an overabundance of nutrients in a water body, resulting in…
Q: What is the Pest control for tomatoes
A: Pests are defined as insects or other organisms that destroy the crop. Different plants and crops…
Q: Describe the steps to get oil from its natural state to market.
A: Once crude oil is extracted from the ground, it must be transported and refined into petroleum…
Q: Given the parameters below:1. u(max) = 1.0/ h Ks = 10 uM2. u(max) = 0.7/h Ks = 2 uM) a. sketch the…
A: For many enzymatic reactions, the graph between substrate concentration and velocity of the reaction…
Q: A. Plant Nutrition A gumamela is a an example of an autotrophs. 1. Which of the following is another…
A: Autotrophs/Producers Organisms that use light energy from the sun to produce food is called as…
Q: When I am doing a Generation time graph with Log CFU/mL vs Time I am getting a straight line instead…
A: The four main phases of the growth cycle are lag phase, log (exponential) phase, stationary phase,…
Q: The harvested carrots stored under 30oC (room temperature) changes it weights every day. Why?
A: Carrot is a conical, fleshy, tap root biennial herb. It has medicinal values as it has anti-…
Q: The harvested carrots stored under 30oC (room temperature) changes it weights every day. Why? How to…
A: Carrots are high in vitamins A, vitamin C, potassium, iron, copper and also possess a high amount of…
Step by step
Solved in 3 steps
- Document2 - Microsoft Word O Search A meiseintobien420@gmail.com M Design Layout References Mailings Review View Help ca 12 A A Aa AEEE EE ¶ AaBbCcDc AaBbCcDc AaBbCc AABBCCC AaB U v. ab x, x A . O 1 Normal 1 No Spac. Heading 1 Heading 2 Title Paragraph Styles Font t been activated. To keep using Word without interruption, activate before Thursday, March 25, 2021. Activate fever, chills, nasal congestion, and a sore throat. The patient's mother indicates that the child had been ill for the past two days, experiencing a poor appetite and sleepiness. The nurse swabs the patient's throat for rapid microbial analysis, suspecting the patient's symptoms are due to a common pathogen. 6) The rapid microbial analysis is negative for group A Streptococcus and reveals the presence of only normal biota in the patient specimen. Based upon this information, all of the following microbes can be ruled out in the diagnosis except *Key word "normal biota" A) Streptococcus pyogenes (Gram-positive coccus)…AutoSave Document1 - Compatibility Mode - Word Search 困 Of steve M SM File Home Insert Draw Design Layout References Mailings Review View Help E Share O Comments 21. What happens to sodium channels and potassium channels during repolarization of a neuron? A. both potassium channels and sodium channels remain closed B. the sodium channels close, followed by opening of the potassium channels C. both sodium channels and potassium channels remain closed D. the sodium channels open, but the potassium channels remain closed E. both potassium channels and sodium channels remain open 22. The above repolarization of a neuron will result in which of the following ionic currents? A. a potassium current will transport K+ ions out of the cytoplasm B. a sodium current will transport Na+ ions out of the cytoplasm C. a potassium current will transport K* ions into the cytoplasm D. a sodium current will transport Nat ions into the cytoplasm E. a sodium current will transport K* ions into the cytoplasm…X w ASSIGNMENT Define each term X Os://onedrive.live.com/edit.aspx?resid=40F4BEB72DD81FC21540&ithint=file%2cdocx&ct=1694280480854&wdOrigin=OFFICECOM-WEB.START.UPLOAD&wd tword - Search X T Define each term listed and give an example (2) Layout References Review View Help Table Design Table Layout Calibri (Body) B I U abx, x² Aa 126 words V 12 V Font Word | Microsoft 365 Name: A A Po 5-16-17-3 A. NDQ Deficient 1. 2. 3. EEEEE Oxygenation Search (Alt + Q) Paragraph English (US) Text Predictions: On Editor Suggestions Showing 1. 1. Define each term listed as the Nursing Diagnosis Qualifier (NDQ). 2. Provide three (3) Nursing Diagnosis Statements when an alteration occurs within the concepts of oxygenation, perfusion, fluid & electrolytes, tissue integrity, and thermoregulation. 2. ¶ 3. ¶ Perfusion Desktop 1 AaBbCe Normal D 1. 2. Word | Microsoft 365 3. AaBbCc No Spacing Fluid & Electrolytes 1. 2. 3. AaBbCc Heading 1 Styles New desktop xa gmail login mail - Search Tissue Integrity + AaBbcc…
- n/presentation/d/1S82GnwbkoPM00ZSobTUJDuHv_lcoHEBrUhtlilwruug/edit#slide%3Did.g.. o P Tools Add-ons Help Last edit was yesterday at 3:20 PM 田 Background Layout- Theme Transition I| 1 I.2 | 3 LI4 l. 5 6 I 7 . 8. | I Dis ussion hink alon What happens when you get food poisoning or the flu? How does our body fight an infection when we get sick? MS-LS1-3. Use argument supported by evidence for how the body is a system of interacting subsystems composed of groups of cells ASUSule_2023_Spring_Stu x M Inbox (1) - Ic21-0506@lclari X =6104_EP#6 - Google Docs ent/d/104sNODGApfrUg768nDS9piPmOB-VzXs86b_t-tDcDF8/edit My Drive - Google... WebAdvisor Main... ols Extensions Zotero Help text T Arial Haplontic life cycle Diplontic life cycle Parthenogenesis Karyotype Histone - 11 + 2 4. Match the words with the correct definitions: | Alternation of generations Job Listing - USF... WT Enrollment Requir... B I U 3 4 X 0 Lecture Video: The Cell Cyc x Chemical Principl... UO UND Orn Z = - 1:3 A type of reproduction that produces a clone of the mother A protein DNA wraps around it to condense the DNA An organism alternates between 1n and 2n with each generation A complete set of chromosomes, as they appear in the nucleus When an organism spends most of its life in the 1n state When an organism spends most of its life in the 2n state 11W AutoSave Off H 2-0 = brief v File Home Insert Draw X Paste Clipboard Page 2 of 2 23°C Sunny Calibri (Body) I U BIU 867 words m Design Layout 12 A A Aa A D✓ A✓ x² A ab ab x₂ x Font References Mailings Review View Help AL T 5 Search 165-15-16- E = = = ~ Name: Jasmine Cooper MRN: 210735 Gender: Female D.O.B: 02 November 1990 Allergies: NKA Marital Status: Married Paragraph Admitting Doctor: Amelia Ong Aboriginal and Torres Strait Islander: No SITUATION: Jasmine (Jas), 32 years old, was brought into Emergency Department (ED) by ambulance. She called the ambulance after an intentional overdose of her prescribed medications and cutting her left wrist. She smelt heavily of alcohol when she arrived in ED. Jas was drowsy with an unsteady gait but was hemodynamically stable. The ED Psychiatrist reviewed Jas and admitted her involuntarily under the Mental Health Act. She is awaiting medical clearance before transfer to the acute mental health unit. ADMISSION ASSESSMENT: On assessment, Jas was…
- Layout References Mar Review View +. Add Pen Tell me Trackpad MacBook Air X Share ComW = 5-67 Home File 70 Paste |LI SALAAAAAAA Cut E Copy H Page: 1 of 1 Clipboard Insert Page Layout Format Painter Cambria 12 Words: 160 B English Type here to search References Á A BIU Uabe X₂ X² Font T Mailings Aa Aal Review e. O View jo SEEN↓ ¶ AaBbCc[ AaBbCc[ AaBBC AaBb AaBbccc AaB AaBb Ccl AaBb CcD; AaBb CcD₁ AaBb CcD AaBb CcDc 1 Normal 1 No Spaci... Heading 1 Heading 2 Heading 3 Title Subtitle Subtle Em... Emphasis Intense E... Strong Paragraph 1 Pre-Lab #4 - Microsoft Word 2 31 4 Equilibrium (balance and body position). 3 3. The optic nerve carries the special sense of 4. The vestibulocochlear nerve carries the special senses of and 5. The olfactory nerves carry the special sense of through the ,C prime video I of the ethmoid bone. W C Styles 5 5 6.s・・・ 7. I I I and extend 7°C Sunny АА Change Styles BR> = 140% - Co (4) ENG G 0 x Find ab Replace час Select Editing □ 8:07 AM 9/29/2022 E V +Please do not copy and paste from google, Explain all option why they are correct and why they are incorrect . I need help
- What are the advantages and disadvantages of using the Hanging drop technique? Please elaborate thankyou, please put it in a table instead of picture as i am having a problem clarfiying the handwriting, thank you so mch6. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…Launch X E Jakiya C X A EXTRA ( x E Extra Cr X E Jakiya ( x C Clever| X The Ru ogle.com/forms/d/e/1FAIPQLSC_f0qa9wBGsAJhQQKBaFaj05NbyZW7CHYBtPVROqPFdE7jFw/viewform?hr_submi rks G how to enable devel.. New Tab OHDYPEBKKKKKK. A student read about the peppered moth, a species whose population changed over a period of time. Before the Industrial Revolution, dark-colored moths were rare. During the Industrial Revolution, however, the population of dark-colored moths greatly increased. The student thought that the reason for the increase in dark-colored moths was soot covering the wings of the light-colored moths. She thought this coloring was then passed on to the offspring of the light-colored moths. Which statement should be used to explain to the student the correct reason for how this population changed over time? * The dark-colored moths could fly faster than the light-colored moths. The dark-colored moths found food more easily than the light-colored moths The dark-colored moths hid…