
Biochemistry: Concepts and Connections
1st Edition
ISBN: 9780321839923
Author: Dean R. Appling, Spencer J. Anthony-Cahill, Christopher K. Mathews
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 6, Problem 8P
The following sequence is part of a globular protein. Predict the secondary structure in this region.
…RRPVVLMAACLRPVVFITYGDGGTYYHWYH…
Expert Solution & Answer

Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
12. When glutamic acid is heated to 180°C., it loses a molecule of water to form a
lactam. The bond that creates the lactam is an amide bond that forms between the
amino nitrogen and the carbon of the side chain -COOH group. What is the most
reasonable structure for this lactam? (NOTE: The structure of glutamic acid is shown
in Question 1.)
COOH
COOH
ا کچھ جو کچھ
C
D
COOH
B
COOH
E
COOH
10. Which one of the
following compounds is
the major organic product
of the series of reactions
shown here?
Ph
A
OH
Ph
B
CO₂Et
Br
-H
Ν ΚΑ
CO₂Et
1. NaOEt
1. NaOH, H₂O
2. H3O+
2. PhCH2CH2Br
3. heat
NH2
Ph
OH
NH2
0
OH
Ph
OH
NH2
Ph
D
NH2
E
OH
1. What is the isoelectric point of glutamic acid?
(Glutamic acid has pKa1 2.10, pKa2 4.07, pKaз 9.47)
A) pH 2.1
D) pH 6.8
B) pH 3.1
C) pH 4.1
E) pH 9.5
HO
NH2
Glutamic acid
(shown without charges)
OH
Chapter 6 Solutions
Biochemistry: Concepts and Connections
Ch. 6 - Prob. 1PCh. 6 - Bovine pancreatic trypsin inhibitor (BPTI; Figure...Ch. 6 - A schematic structure of the subunit of...Ch. 6 - In the protein adenylate kinase, the C-terminal...Ch. 6 - Give two reasons to explain why a proline residue...Ch. 6 - Consider a small protein containing 101 amino acid...Ch. 6 - a. Based on a more conservative answer to Problem...Ch. 6 - The following sequence is part of a globular...Ch. 6 - a. A protein is found to be a tetramer of...Ch. 6 - Under physiological conditions, the protein...
Ch. 6 - Theoretical and experimental measurements show...Ch. 6 - The peptide hormone vasopressin is used in the...Ch. 6 - A protein gives under conditions of buffer...Ch. 6 - A protein gives a single band on SDS get...Ch. 6 - It has been postulated that the normal...Ch. 6 - Prob. 16PCh. 6 - Do you expect a Pro Gly mutation in a...Ch. 6 - Rank the following in terms of predicted rates...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.Similar questions
- Br Mg, ether 1. HCHO (formaldehyde) 2. H+, H₂O PCC 1. NH3, HCN ? (pyridinium chlorochromate) 2. H2O, HCI 11. Which one of the following compounds is the major organic product of the series of reactions shown above? Ph. Ph. OH NH2₂ A Ph. Ή NH2 B OH Ph Η Ph OH NH2 NH2₂ NH₂ C D Earrow_forwardB A 6. Which ONE of the labeled bonds in the tripeptide on the right is a peptide bond: H₂N N 'N' OH C H A, B, C, D or E? HN E OHarrow_forwardQuestions 8-9 are 0.4 points each. The next two questions relate to the peptide whose structure is shown here. To answer these questions, you should look at a table of H2N/.. amino acid structures. You don't have to memorize the structures of the amino acids. IZ 8. What is the N-terminal amino acid of this peptide? A) proline B) aspartic acid C) threonine 9. What is the C-terminal amino acid of this peptide? A) proline B) aspartic acid C) threonine N OH D) valine E) leucine D) valine E) leucine NH "OH OHarrow_forward
- 7. What is the correct name of the following tripeptide? A) Ile-Met-Ser B) Leu-Cys-Thr C) Val-Cys-Ser D) Ser-Cys-Leu E) Leu-Cys-Ser H₂N!!!!! N H ΖΙ .SH SF H IN OH OHarrow_forwardPlease draw out the following metabolic pathways: (Metabolic Map) Mitochondrion: TCA Cycle & GNG, Electron Transport, ATP Synthase, Lipolysis, Shuttle Systems Cytoplasm: Glycolysis & GNG, PPP (Pentose Phosphate Pathway), Glycogen, Lipogenesis, Transporters and Amino Acids Control: Cori/ Glc-Ala cycles, Insulin/Glucagon Reg, Local/Long Distance Regulation, Pools Used Correctlyarrow_forwardPlease help provide me an insight of what to draw for the following metabolic pathways: (Metabolic Map) Mitochondrion: TCA Cycle & GNG, Electron Transport, ATP Synthase, Lipolysis, Shuttle Systems Cytoplasm: Glycolysis & GNG, PPP (Pentose Phosphate Pathway), Glycogen, Lipogenesis, Transporters and Amino Acids Control: Cori/ Glc-Ala cycles, Insulin/Glucagon Reg, Local/Long Distance Regulation, Pools Used Correctlyarrow_forward
- f. The genetic code is given below, along with a short strand of template DNA. Write the protein segment that would form from this DNA. 5'-A-T-G-G-C-T-A-G-G-T-A-A-C-C-T-G-C-A-T-T-A-G-3' Table 4.5 The genetic code First Position Second Position (5' end) U C A G Third Position (3' end) Phe Ser Tyr Cys U Phe Ser Tyr Cys Leu Ser Stop Stop Leu Ser Stop Trp UCAG Leu Pro His Arg His Arg C Leu Pro Gln Arg Pro Leu Gin Arg Pro Leu Ser Asn Thr lle Ser Asn Thr lle Arg A Thr Lys UCAG UCAC G lle Arg Thr Lys Met Gly Asp Ala Val Gly Asp Ala Val Gly G Glu Ala UCAC Val Gly Glu Ala Val Note: This table identifies the amino acid encoded by each triplet. For example, the codon 5'-AUG-3' on mRNA specifies methionine, whereas CAU specifies histidine. UAA, UAG, and UGA are termination signals. AUG is part of the initiation signal, in addition to coding for internal methionine residues. Table 4.5 Biochemistry, Seventh Edition 2012 W. H. Freeman and Company B eviation: does it play abbreviation:arrow_forwardAnswer all of the questions please draw structures for major productarrow_forwardfor glycolysis and the citric acid cycle below, show where ATP, NADH and FADH are used or formed. Show on the diagram the points where at least three other metabolic pathways intersect with these two.arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage LearningBiology Today and Tomorrow without Physiology (Mi...BiologyISBN:9781305117396Author:Cecie Starr, Christine Evers, Lisa StarrPublisher:Cengage LearningBiochemistryBiochemistryISBN:9781305577206Author:Reginald H. Garrett, Charles M. GrishamPublisher:Cengage Learning

Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning

Biology Today and Tomorrow without Physiology (Mi...
Biology
ISBN:9781305117396
Author:Cecie Starr, Christine Evers, Lisa Starr
Publisher:Cengage Learning

Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning
Biomolecules - Protein - Amino acids; Author: Tutorials Point (India) Ltd.;https://www.youtube.com/watch?v=ySNVPDHJ0ek;License: Standard YouTube License, CC-BY