Biochemistry
Biochemistry
9th Edition
ISBN: 9781319114671
Author: Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.
Publisher: W. H. Freeman
bartleby

Concept explainers

bartleby

Videos

Question
Book Icon
Chapter 6, Problem 1P
Interpretation Introduction

Interpretation: The score for the given alignment is to be calculated using the identity-based scoring system. Also, whether the given proteins are related to each other or not is to be identified.

Concept introduction: Proteins are the biomolecules which are composed of the long chain of amino acid residues. The identical sequences or the primary structure in nucleic acids or proteins are known as conserved sequences. The highly conserved sequences consist of RNA components of ribosomes in all kingdoms of life.

Expert Solution & Answer
Check Mark

Answer to Problem 1P

The score for the given alignment is 220 . The given proteins evolutionary related to each other and are structurally identical.

Explanation of Solution

The given alignments of proteins are shown below.

  1. WYLGKITRMDAEVLLKKPTVRDGGHFLVTQCESSPGEF2. WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAY     SISVRFGDSVQ-----HFKVLRDQNGKYYLWAVK-FN     CLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFS

       SLNELVAYHRTASVSRTHTILLSDMNV     SSLQQLVAYYSKHADGLCHRLTNV

In the above alignments, there are 27 identities and 2 gaps. Each identity between aligned sequences results in +10 points. On the other hand, each gap introduced, regardless of size it results in 25 points. Therefore, the score for the given alignment is calculated as follows,

  Score=(27×10)(2×25)=27050=220

Hence, the score for the given alignment is 220 .

The above two sequences has 27 identities. Therefore, they are 27% identical over almost 100 residues. Hence, these proteins evolutionary related to each other and are structurally identical.

Conclusion

  220 is the score for the given alignment. The given proteins evolutionary related to each other and are identical structurally.

Want to see more full solutions like this?

Subscribe now to access step-by-step solutions to millions of textbook problems written by subject matter experts!
Students have asked these similar questions
Assessment +1501 pts /1600 Resources Solution ? Hint Sub bo Each pictured Lewis structure is invalid. Identify the error in each case. O Macmillan Learning :0▬▬0: Answer Bank wrong electron total :0- :F======F: octet-rule violation N :0:
[s] mM V (M/s) Uninhibited 0.333 1.65 x 107 1.05 x 107 V (M/s) x 10' Inhibitor A V (M/s) x 107 Inhibitor B 0.794 x 107 0.40 1.86 x 107 1.21 x 107 0.893 x 107 0.50 2.13 x 107 1.43 x 107 1.02 x 107 0.666 2.49 x 107 1.74 x 107 1.19 x 107 1.0 2.99 x 107 2.22 x 107 1.43 x 107 2.0 3.72 x 107 3.08 x 107 1.79 x 107
For a Michaelis-Menten reaction, k₁-5 x 10'/M-s, k.-2 x 10%/s, and k₂-4 x 10²/s. a) Calculate the Ks and KM for this reaction. b) Does substrate binding achieve equilibrium or steady state?
Knowledge Booster
Background pattern image
Biochemistry
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.
Similar questions
SEE MORE QUESTIONS
Recommended textbooks for you
Text book image
Biology: The Dynamic Science (MindTap Course List)
Biology
ISBN:9781305389892
Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan
Publisher:Cengage Learning
Text book image
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
Text book image
Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning
Text book image
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Text book image
Nutrition Now
Health & Nutrition
ISBN:9781337415408
Author:Brown
Publisher:Cengage
Text book image
Essentials of Pharmacology for Health Professions
Nursing
ISBN:9781305441620
Author:WOODROW
Publisher:Cengage
The Cell Membrane; Author: The Organic Chemistry Tutor;https://www.youtube.com/watch?v=AsffT7XIXbA;License: Standard youtube license