Biochemistry
Biochemistry
8th Edition
ISBN: 9781464126109
Author: Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr., Lubert Stryer
Publisher: W. H. Freeman
bartleby

Concept explainers

bartleby

Videos

Question
Book Icon
Chapter 6, Problem 1P
Interpretation Introduction

Interpretation: The score for the given alignment is to be calculated using the identity-based scoring system. Also, whether the given proteins are related to each other or not is to be identified.

Concept introduction: Proteins are the biomolecules which are composed of the long chain of amino acid residues. The identical sequences or the primary structure in nucleic acids or proteins are known as conserved sequences. The highly conserved sequences consist of RNA components of ribosomes in all kingdoms of life.

Expert Solution & Answer
Check Mark

Answer to Problem 1P

The score for the given alignment is 220 . The given proteins evolutionary related to each other and are structurally identical.

Explanation of Solution

The given alignments of proteins are shown below.

  1. WYLGKITRMDAEVLLKKPTVRDGGHFLVTQCESSPGEF2. WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAY     SISVRFGDSVQ-----HFKVLRDQNGKYYLWAVK-FN     CLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFS

       SLNELVAYHRTASVSRTHTILLSDMNV     SSLQQLVAYYSKHADGLCHRLTNV

In the above alignments, there are 27 identities and 2 gaps. Each identity between aligned sequences results in +10 points. On the other hand, each gap introduced, regardless of size it results in 25 points. Therefore, the score for the given alignment is calculated as follows,

  Score=(27×10)(2×25)=27050=220

Hence, the score for the given alignment is 220 .

The above two sequences has 27 identities. Therefore, they are 27% identical over almost 100 residues. Hence, these proteins evolutionary related to each other and are structurally identical.

Conclusion

  220 is the score for the given alignment. The given proteins evolutionary related to each other and are identical structurally.

Want to see more full solutions like this?

Subscribe now to access step-by-step solutions to millions of textbook problems written by subject matter experts!
Students have asked these similar questions
Biochemistry What is the process of "transamination" in either the muscles or the liver, that involves keto acid or glutamic acid? Please explain how the steps work. Thank you!
Biochemistry Please help. Thank you What is the importance of glutamic acid in the metabolism of nitrogen from amino acids? (we know therole; it’s used to remove the nitrogen from amino acids so that the remaining carbon skeleton can bebroken down by the “usual” pathways, but what is the important, unique role that only glutamicacid/glutamate can do?)
Biochemistry Please help. Thank you When carbamyl phosphate is joined to L-ornathine, where does the energy for the reaction come from?
Knowledge Booster
Background pattern image
Biochemistry
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.
Similar questions
SEE MORE QUESTIONS
Recommended textbooks for you
Text book image
Biochemistry
Biochemistry
ISBN:9781319114671
Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.
Publisher:W. H. Freeman
Text book image
Lehninger Principles of Biochemistry
Biochemistry
ISBN:9781464126116
Author:David L. Nelson, Michael M. Cox
Publisher:W. H. Freeman
Text book image
Fundamentals of Biochemistry: Life at the Molecul...
Biochemistry
ISBN:9781118918401
Author:Donald Voet, Judith G. Voet, Charlotte W. Pratt
Publisher:WILEY
Text book image
Biochemistry
Biochemistry
ISBN:9781305961135
Author:Mary K. Campbell, Shawn O. Farrell, Owen M. McDougal
Publisher:Cengage Learning
Text book image
Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning
Text book image
Fundamentals of General, Organic, and Biological ...
Biochemistry
ISBN:9780134015187
Author:John E. McMurry, David S. Ballantine, Carl A. Hoeger, Virginia E. Peterson
Publisher:PEARSON
The Cell Membrane; Author: The Organic Chemistry Tutor;https://www.youtube.com/watch?v=AsffT7XIXbA;License: Standard youtube license