PRESCOTT'S MICROBIOLOGY
11th Edition
ISBN: 2818440045677
Author: WILLEY
Publisher: MCG
expand_more
expand_more
format_list_bulleted
Concept explainers
Videos
Textbook Question
Chapter 26.2, Problem 1.1CC
Explain why the T4 genome is circularly permuted.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
Give typed full explanation
A gene contains the sequence CGCATACGGTAC that results in the amino acid sequence arg-ile-arq-
tyr. A mutation in this gene has a G inserted after the second C in the strand.
How will this mutation affect the phenotype?
A)This will affect the phenotype because although most of the protein will be identical, the first amino
acid will be different.
B)This will not affect the phenotype because only the second amino acid is different from the original
protein.
C)This will not affect the phenotype because the protein will be identical to the original protein.
D)This will affect the phenotype because all of the amino acids after the first one will be different from
the original protein.
Shown is part of the coding strand of the HBB gene involved in sickle cell disease. What will be the effect on the resulting peptide of a deletion of the two nucleotides shown in bold/underline?
5' CTG ACT CCT GAG GAC 3'
a) A change from glutamic acid to valine will occur
b) The deletion will not result in a change to the polypeptide
c) A nonsense mutation will occur
d) The polypeptide will be missing one amino acid, but the reading frame will be preserved
Chapter 26 Solutions
PRESCOTT'S MICROBIOLOGY
Ch. 26.1 - List some characteristics used in classifying...Ch. 26.1 - Prob. 2CCCh. 26.2 - Prob. 1MICh. 26.2 - Why do you think T4 evolved to initiate DNA...Ch. 26.2 - What function does HMC glycosylation serve?Ch. 26.2 - Explain why the T4 genome is circularly permuted.Ch. 26.2 - Prob. 1.2CCCh. 26.2 - How is a prophage induced to become active again?Ch. 26.2 - Describe the roles of cII, CIII, repressor (CI),...Ch. 26.2 - How do the temperate phages Mu and P1 differ from...
Ch. 26.2 - How is the envelope of this virus formed? How does...Ch. 26.2 - Why do cold sores recur throughout the lifetime of...Ch. 26.2 - In what part of the host cell does a herpesvirus...Ch. 26.2 - Many small DNA viruses rely on host enzymes for...Ch. 26.3 - Why is the X174 genome considered plus stranded?Ch. 26.3 - Why is it necessary for some ssDNA viruses to...Ch. 26.3 - Prob. 2CCCh. 26.3 - How do parvoviruses trick the host DNA polymerase...Ch. 26.4 - The rotavirus genome encodes 12 proteins. Suggest...Ch. 26.4 - Describe the life cycle of 6 phage. What makes...Ch. 26.4 - Prob. 3CCCh. 26.4 - In what ways are the life cycles of 6 and...Ch. 26.5 - Where in the host does the plus-strand RNA genome...Ch. 26.5 - How do some plus-strand viruses use polyproteins...Ch. 26.5 - What is an IRES? Why is it important?Ch. 26.5 - Prob. 3CCCh. 26.6 - How does that use of a segmented genome by...Ch. 26.6 - Prob. 2CCCh. 26.7 - Prob. 1MICh. 26.7 - Prob. 1CCCh. 26.7 - Prob. 2CCCh. 26.7 - Prob. 3CCCh. 26.8 - Prob. 1CCCh. 26.8 - Trace the HBV multiplication cycle, paying...Ch. 26 - Prob. 1RCCh. 26 - Prob. 2RCCh. 26 - Prob. 3RCCh. 26 - Prob. 4RCCh. 26 - No temperate RNA phages have yet been discovered....Ch. 26 - The choice between lysogeny and lysis is...Ch. 26 - Prob. 3ALCh. 26 - You are studying RNA viruses and have discovered a...Ch. 26 - Prob. 5ALCh. 26 - Prob. 6AL
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Discuss the genetic switch that controls the lytic versus lysogenic path in bacteriophage lambda.arrow_forwardThe bacteriophage genome consists primarily of genes encodingproteins that make up the head, collar and tail, and tail fibers When these genes are transcribed following phage infection, howare these proteins synthesized, since the phage genome lacksgenes essential to ribosome structure?arrow_forwardThe bacteriophage genome consists of many genes encoding proteins that make up the head, collar, tail, and tail fibers. When these genes are transcribed following phage infection, how are these proteins synthesized, since the phage genome lacks genes essential to ribosome structure?arrow_forward
- Inhibiting the reverse transcriptase of HIV is a common method for treating HIV infections. a) The HIV reverse transcriptase has two separate functional domains. One domain has polymerase activity. What type of activity do you think the other domain would have?arrow_forwardThe genome of SARS-CoV-2 is a single-stranded sense (coding) mRNA that is translated into many functional and structural proteins required for the replication and assembly of the virus, including the famous spike protein. Comparing the sequence to that of SARS-CoV-1 and a number of other beta-coronaviruses reveals that by far the most conserved sequence within the entire ~30,000 nucleotide mRNA genome is located in the 3'-UTR, near the end of the message. The difference between that sequence in the original isolates of SARS-CoV-2 is only 1 in 50 nucleotides. What is the most likely explanation for this high degree of sequence conservation? The mRNA in this region encodes for a protein with a required proteus site to make the mature viral coat protein that participates in membrane fusion, without which the virus cannot propagate. The mRNA in this region encodes for an essential protein whose fold cannot tolerate amino acid substitutions. The mRNA in this region is part of a required…arrow_forwardResearchers have been determining the nucleotide sequences of variant forms of SARS-CoV-2, looking for versions of the virus that might be more easily transmitted between humans or that might be more deadly. (a) For example, one mutation in a viral gene changed a GAU codon to a GGU codon. How does this change affect the sequence of the polypeptide encoded by that gene? (b) In another variant form of the virus, a gene is missing six consecutive nucleotides. How would this change affect the sequence of the polypeptide encoded by that gene? (c) In another coronavirus variant, the spike protein (the prominent protein on the surface of the virus) contains a histidine residue where an aspartate (aspartic acid) residue should be. Describe a point mutation in the coronavirus genome that could have caused this change in the spike protein.arrow_forward
- If the following nucleotide sequence represents the active domain of the COVID19’s M-protein 5’ ---- 5’ GGGUACAUGGUAGCCCCCGUCGAGAAAACACCC …. 3’ a) describe a potential mutation that may occur and the mechanism that could fix it b) if the repair mechanism is faulty, explain the consequences for COVID19 & that of the infected individualarrow_forwardDetermine the map distances between the genes.arrow_forwardGive 4 examples of transcription factors / non-structural proteins you have learned in this course? Identify the most commonly used technique for diagnosing COVID-19? And the clinical sample for each technique. …….…… virus can cause encephalitis, cancer, sexually transmitted disease, infect external genitalia, mucosal surfaces, gladiatorum, and/or other diseases. How can the infection with this virus be avoided? Suggest two ways of prevention or to destroy the virus.arrow_forward
- Coronavirus from bats to animals, sequence comparison: Note: dots mean amino acid is the same as the one in the top sequence. Human Virus AGNNPLQTYVIACQDGGERRAAQDMFSAKKGGQTPAYWGC Civet Cat Virus G..... ......K....E.....R. .W. Pangolin Virus GA.Q....W..G....C.L..V.E....Q.. Bat Virus B Bat Virus AG .A.Q....W..G....C.L.. .....K. Y.. .N.G.T.A .2.. .N.G.T.A .R.......Y.. A researcher isolates a coronavirus from humans that they believe came from Bat virus A or Bat virus B. They also think the virus may have first gone through pangolins or civet cats. Shown above is an amino acid sequence comparison in the region of the virus spike protein that binds to the cell receptor. All viruses are compared to the human virus with colored dots indicating the same amino acid at that position and letters representing the amino acid change at the particular position. Answer the questions below using the figure. Question 1 (3 points). Does this data support the idea that the human virus is derived from a…arrow_forwardModerna and Pfizer vaccines for COVID-19 use mRNA to the Spike protein combined with lipids. Which of the following is/are advantages of this type of vaccine compared to an inactivated virus vaccine? Select ALL correct answers. a) The vaccine is more stable for transport. b) The vaccine does not contain the virus so it cannot give you COVID-19. c) The vaccine can be rapidly produced in a slightly different form to protect from variants of SARS-CoV-2. d) The vaccine does not need a booster.arrow_forwardwhen various strains of lambda phage are seeded on a lawn of e.coli, they can form clear or turbid plaques. Explain the difference between the two types of plaques. can all bacteriophage form clear and turbid plaques?arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSON
Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
Anatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education
Bacterial Genomics and Metagenomics; Author: Quadram Institute;https://www.youtube.com/watch?v=_6IdVTAFXoU;License: Standard youtube license