GENETICS(LL)-W/CONNECT >CUSTOM<
6th Edition
ISBN: 9781260571561
Author: HARTWELL
Publisher: MCG CUSTOM
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 19, Problem 4P
Hypomorphic mutations in the wingless gene of Drosophila result in animals lacking wings.
a. | Starting with a set of wingless mutations, how could researchers have identified the wingless gene in the Drosophila genome sequence? |
b. | Part of the amino acid sequence encoded by the ORF of the wingless gene is: (N)…EAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRL…(C) Perform a protein blast at the following website to ask whether the human genome has a gene related to the fly wingless gene: https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome Enter Homo sapiens (taxid:9606) as the organism. Leave all the other settings in their default state, and hit the blue BLAST button at the bottom of the page. The results of the database search will appear in a few minutes. What do the results of the search tell you about the existence of human genes homologous to the fly wingless gene? |
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
Which of the following is the process that is "capable of destroying all forms of microbial life"?
Question 37 options:
Surgical scrub
Sterilization
Chemical removal
Mechanical removal
After you feel comfortable with your counting method and identifying cells in the various stages of mitosis, use the four images below of whitefish blastula to count the cells in each stage until you reach 100 total cells, recording your data below in Data Table 1. (You may not need to use all four images. Stop counting when you reach 100 total cells.)
After totaling the cells in each stage, calculate the percent of cells in each stage. (Divide total of stage by overall total of 100 and then multiply by 100 to obtain percentage.)
Data Table 1Stage Totals PercentInterphase Mitosis: Prophase Metaphase Anaphase Telophase Cytokinesis Totals 100 100%
To find the length of time whitefish blastula cells spend in each stage, multiply the percent (recorded as a decimal, in other words take the percent number and divide by 100) by 24 hours. (Example: If percent is 20%, then Time in Hours = .2 * 24 = 4.8) Record your data in Data…
What are Clathrin coated vesicles and what is their function?
Chapter 19 Solutions
GENETICS(LL)-W/CONNECT >CUSTOM<
Ch. 19 - Match each of the terms in the left column to the...Ch. 19 - a. If you were interested in the role of a...Ch. 19 - Early C. elegans embryos display mosaic...Ch. 19 - Hypomorphic mutations in the wingless gene of...Ch. 19 - Prob. 5PCh. 19 - In 1932, H. J. Muller suggested a genetic test to...Ch. 19 - a. Explain how you could use worms transformed...Ch. 19 - Suppose you want to determine whether a particular...Ch. 19 - Sevenless is an unusual receptor protein in that...Ch. 19 - Suppose that you generated flies containing a...
Ch. 19 - Drosophila researchers have collected many strains...Ch. 19 - As an alternative to random mutagenesis,...Ch. 19 - A C. elegans nematode gene called par-1 helps to...Ch. 19 - The molecular identity of the fruit fly rugose...Ch. 19 - To determine the focus of action of boss,...Ch. 19 - Suppose a particular gene is required for early...Ch. 19 - Researchers have exploited Minute mutations in...Ch. 19 - Some ts alleles are temperature sensitive during...Ch. 19 - The following figure shows the temperature-shift...Ch. 19 - A temperature-sensitive allele of the gene...Ch. 19 - Hypomorphic alleles of a pleiotropic gene...Ch. 19 - In addition to the maternal effect genes that...Ch. 19 - The yan gene encodes a transcription factor that...Ch. 19 - Recall from Chapter 17 that in Drosophila, sex...Ch. 19 - a. Explain the difference between maternal...Ch. 19 - In the 1920s, Arthur Boycott, working with the...Ch. 19 - The Drosophila mutant screen shown on the...Ch. 19 - Some genes are required both zygotically and...Ch. 19 - How would a human with a mutation in a maternal...Ch. 19 - One important demonstration that Bicoid is an...Ch. 19 - The hunchback gene contains a 5 transcriptional...Ch. 19 - In flies developing from eggs laid by a...Ch. 19 - Wild-type embryos and mutant embryos lacking the...Ch. 19 - The Drosophila even-skipped eve gene has four...Ch. 19 - In Drosophila with loss-of-function mutations...Ch. 19 - It is crucial to the development of Drosophila...Ch. 19 - In the plant Arabidopsis thaliana, every flower is...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- How is a protein destined for the Endoplasmic Reticulum (ER), imported into the ER? Be concise.arrow_forwardFind out about the organisations and the movements aimed at the conservation of our natural resources. Eg Chipko movement and Greenpeace. Make a project report on such an organisation.arrow_forwardWhat are biofertilizers and mention the significancearrow_forward
- PCBs and River Otters: Otters in Washington State’s Green-Duwamish River have high levels of polychlorinated biphenyls (PCBs) in their livers. PCBs can bind to the estrogen receptors in animals and disrupt the endocrine system of these otters. The PCBs seem to increase the estrogen to androgen ratio, skewing the ratio toward too much estrogen. How would increased estrogen affect the river otter population? Based on your reading of the materials in this unit, what factors can affect fertility in humans? Explain how each of the factors affecting human fertility that you described can disrupt the human endocrine system to affect reproduction.arrow_forwardOther than oil and alcohol, are there other liquids you could compare to water (that are liquid at room temperature)? How is water unique compared to these other liquids? What follow-up experiment would you like to do, and how would you relate it to your life?arrow_forwardSelection of Traits What adaptations do scavengers have for locating and feeding on prey? What adaptations do predators have for capturing and consuming prey?arrow_forward
- Competition Between Species What natural processes limit populations from growing too large? What are some resources organisms can compete over in their natural habitat?arrow_forwardSpecies Interactions Explain how predators, prey and scavengers interact. Explain whether predators and scavengers are necessary or beneficial for an ecosystem.arrow_forwardmagine that you are conducting research on fruit type and seed dispersal. You submitted a paper to a peer-reviewed journal that addresses the factors that impact fruit type and seed dispersal mechanisms in plants of Central America. The editor of the journal communicates that your paper may be published if you make ‘minor revisions’ to the document. Describe two characteristics that you would expect in seeds that are dispersed by the wind. Contrast this with what you would expect for seeds that are gathered, buried or eaten by animals, and explain why they are different. (Editor’s note: Providing this information in your discussion will help readers to consider the significance of the research).arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage LearningBiology: The Dynamic Science (MindTap Course List)BiologyISBN:9781305389892Author:Peter J. Russell, Paul E. Hertz, Beverly McMillanPublisher:Cengage LearningBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
- Biology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage LearningBiology: The Unity and Diversity of Life (MindTap...BiologyISBN:9781305073951Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa StarrPublisher:Cengage LearningBiochemistryBiochemistryISBN:9781305577206Author:Reginald H. Garrett, Charles M. GrishamPublisher:Cengage Learning
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
Biology: The Dynamic Science (MindTap Course List)
Biology
ISBN:9781305389892
Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan
Publisher:Cengage Learning
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning
Biology: The Unity and Diversity of Life (MindTap...
Biology
ISBN:9781305073951
Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa Starr
Publisher:Cengage Learning
Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning
Genome Annotation, Sequence Conventions and Reading Frames; Author: Loren Launen;https://www.youtube.com/watch?v=MWvYgGyqVys;License: Standard Youtube License