Campbell Biology in Focus
3rd Edition
ISBN: 9780134710679
Author: Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Rebecca Orr
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Videos
Textbook Question
Chapter 17.2, Problem 2CC
MAKE CONNECTIONS The RNA virus in Figure 17.7 has a viral RNA polymerase that functions in step 3 of the virus’s replicative cycle. Compare this with a cellular RNA polymerase In terms of template and overall function (see Figure 14.10).
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
BONUS: Why do RNA viruses such as the COVID coronavirus, influenza virus and HIV have much
higher mutation rates than DNA viruses such as Herpes viruses?
O DNA polymerases which copy viral RNA have much higher mutation rates than RNA polymerases which copy
viral DNA
O RNA polymerases which copy viral RNA have much higher mutation rates than DNA polymerases which copy
viral DNA
RNA viral 60S ribosomes make many ore mutations than DNA viral 40S ribosomes
O RNA viral gyrases make more mistakes than DNA viral helicases
You are studying a new retrovirus. The viral protein (X) appears to play a role in the export of the viral genomes to the
cytoplasm. Protein X brings viral DNA to the cytoplasm and returns back to the nucleus after genome export is complete.
Researchers have developed a new drug for the virus. Following treatment with the new drug, the viral protein stays in the
nucleus and cannot export the viral genomes. What is the most plausible and logical function of the drug? Use your
knowledge of nuclear transport to answer this question.
O A. The drug inhibits the binding of the viral protein and the viral genomes to the import receptor.
B. The drug inhibits the binding of Ran-GTP to the nuclear export receptor in nucleus.
C. The drug promotes the Ran GAP activity.
D. The drug blocks the NLS on the viral protein.
Virology
Chapter 17 Solutions
Campbell Biology in Focus
Ch. 17.1 - Compare the structures of tobacco mosaic virus and...Ch. 17.1 - Prob. 2CCCh. 17.2 - Compare the effect on the host cell of a ly1ic...Ch. 17.2 - MAKE CONNECTIONS The RNA virus in Figure 17.7 has...Ch. 17.2 - Why is HIV called a retrovirus?Ch. 17.2 - MAKE CONNECTIONS Compare the CRISPR system to the...Ch. 17.3 - Describe two ways in which a preexisting virus...Ch. 17.3 - Contrast horizontal and vertical transmission of...Ch. 17.3 - Prob. 3CCCh. 17 - which of me following characteristics. structures....
Ch. 17 - Prob. 2TYUCh. 17 - A human pandemic is A. a viral disease that...Ch. 17 - Prob. 4TYUCh. 17 - RNA viruses require their own supply of certain...Ch. 17 - Prob. 6TYUCh. 17 - Prob. 7TYUCh. 17 - Prob. 8TYUCh. 17 - FOCUS ON ORGANIZATION While viruses are considered...Ch. 17 - SYNTHESIZE YOUR KNOWLEDGE Oseltamivir (Tamiflu),...
Additional Science Textbook Solutions
Find more solutions based on key concepts
Relative thickness of the myocardium in different chambers; the functional significance of those differences; a...
Anatomy & Physiology: The Unity of Form and Function
11. In the early 1800s, French naturalist Jean Baptiste Lamarck suggested that the best explanation for the rel...
Campbell Biology: Concepts & Connections (9th Edition)
Identify each of the following reproductive barriers as prezygotic or postzygotic. a. One lilac species lives o...
Campbell Essential Biology with Physiology (6th Edition)
Single penny tossed 20 times and counting heads and tails: Probability (prediction): _______/20 heads ________/...
Laboratory Manual for Holes Human Anatomy & Physiology Fetal Pig Version
Why are mutants used as test organisms in the Ames test?
Laboratory Experiments in Microbiology (11th Edition)
Describe the evolution of mammals, tracing their synapsid lineage from early amniote ancestors to true mammals....
Loose Leaf For Integrated Principles Of Zoology
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Viruses with negative sense RNA genomes typically, make proteins by: (Ignore retroviruses, and the unusual characteristics of coronaviruses) Translation of short RNA transcripts generated by RDRP Generating a DNA copy, which is then transcribed by host RNA polymerase. Translation of the viral genome by host ribosomes. Production of a polyprotein, which must be cleaved into smaller proteins. Generating a negative sense genome copy, which is then translated by host ribosomes.arrow_forwardProvide a brief description behind your choice? Virus-mediated transfer of cellular genetic material from one bacterial cell to another by means of virus particles is called: (A) transduction (B) transposition (C) transformation (D) transfection One strand of double-stranded DNA is mutated, changing all cytosines to uracils. After one round of replication of the mutated DNA strand, the melting temperature of the resulting DNA will: (A) be higher (B) be lower (C) remain the same (D) be double The Southern blotting technique is used for: (A) the detection of RNA fragments onmembranes by specific radioactiveantibodies (B) the detection of DNA fragments onmembranes by a radioactive DNAprobe (C) the detection of proteins on membranesusing a radioactive DNA probe (D) the detection of DNA fragments onmembranes by specific radioactiveantibodies Superoxide dismutase is an important enzyme for maintenance of red blood cells and is defective insome neurodegenerative diseases. What…arrow_forwardMany virologists note that viruses which have a genome made up of RNA will tend to evolve faster than those viruses whose genome is made up of double-stranded DNA. Most evolutionary biologists now accept that RNA was the first nucleic acid molecule to evolve to store information. Why is this early “RNA world” more likely when you consider how RNA polymerases (such as primase) and DNA polymerases start replicating nucleotide chains?arrow_forward
- 1. Precise words:Find the nonspecific terms in the following sentences. Replace the nonspecific choices with more preciseterms or phrases (It is not necessary to change the sentence structure).(i) All OVE mutants showed enhanced iP concentrations.(ii) Plants were kept in the cold overnight.(iii) To provide proof of concept for our hypothesis, we studied a virus in its host cell.(iv) The present paper reports on continuing experiments that were performed to clarify thissurprising effect.(v) The first transition state is a little lower in energy than the second transition state. 2. Simple words:Improve the word choice in the following examples by replacing the underlined terms or phrases withsimpler word choices (do not change the sentence structure).(i) These data substantiate our hypothesis.(ii) The difference in our results compared to those of Reuter et al. (1995) can be accounted forby the fact that different conditions were used.(iii) For the purpose of discussing cell migration we…arrow_forwardQ10. Does frame +2 have an ORF in the coding region of this exon? What about frame +1 and frame +3? Q11. Given that 3 of the 64 possible codons are stop codons, what is the chance of having a stop codon at any given position, assuming that the sequence is random?arrow_forwardCoronavirus from bats to animals, sequence comparison: Note: dots mean amino acid is the same as the one in the top sequence. Human Virus AGNNPLQTYVIACQDGGERRAAQDMFSAKKGGQTPAYWGC Civet Cat Virus G..... ......K....E.....R. .W. Pangolin Virus GA.Q....W..G....C.L..V.E....Q.. Bat Virus B Bat Virus AG .A.Q....W..G....C.L.. .....K. Y.. .N.G.T.A .2.. .N.G.T.A .R.......Y.. A researcher isolates a coronavirus from humans that they believe came from Bat virus A or Bat virus B. They also think the virus may have first gone through pangolins or civet cats. Shown above is an amino acid sequence comparison in the region of the virus spike protein that binds to the cell receptor. All viruses are compared to the human virus with colored dots indicating the same amino acid at that position and letters representing the amino acid change at the particular position. Answer the questions below using the figure. Question 1 (3 points). Does this data support the idea that the human virus is derived from a…arrow_forward
- Explain the Gene Expression Experiment Re-Analysis Summary of Rabies Virus(Taxon:11292) Explain how The virus attaches to the cell membrane of the host cell via the G protein. How the virus penetrates the cytoplasm and the ribonucleoprotein (RNP) complex is exposed to the cell's machinery. Explain Phylogenetic Analysis and Adenovirus Vaccine Cloning and Rationalization of Rabies Virus.arrow_forwardMicrob an mRNA molecule has the sequence 5'UCA GAA AUG CAC3. Which of the following best describes the tRNA that binds to the third/3rd codon of this mRNA? has anticodon AUG and the amino acid tyrosine It can have any anticodon and any amino acid Has the anticodon UAC and the amino acid methionine Has the anticodon CUU and the amino acid glutamic acid must have the anticodon TAC Has anticodon UUC and the amino acid lysinearrow_forwardRNA polymerase in Escherichia coli normally synthesizes all of the following molecules except: RNA primers during DNA replication messenger RNA (mRNA) transfer RNA (tRNA) ribosomal RNA (rRNA) heterogenous nuclear RNA (hnRNA)arrow_forward
- Can u help me to explain to me, please?arrow_forwardLet's imagine you have discovered a new RNA virus and found a cell line to grow the viruses (lucky you!). Early experiments show virus' genome to be single-stranded RNA but you are unsure if it is positive or negative RNA. Explain how using anisomycin, an eukaryotic protein synthesis inhibitor, could potentially provide an answer.arrow_forwardIn Figure 8-5, draw the “one gene” at much higher resolution with the following components: DNA, RNA polymerase(s), RNA(s).arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
Biology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage Learning
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning
What is Genomics - Full Length; Author: Genome BC;https://www.youtube.com/watch?v=mmgIClg0Y1k;License: Standard youtube license