Concepts of Genetics (11th Edition)
11th Edition
ISBN: 9780321948915
Author: William S. Klug, Michael R. Cummings, Charlotte A. Spencer, Michael A. Palladino
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Videos
Textbook Question
Chapter 1, Problem 9PDQ
How many different proteins, each with a unique amino acid sequence, can be constructed that have a length of five amino acids?
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
HOW MANY DIFFERENT
PROTEINS CAN BE
CONSTRUCTED
THAT ARE
EXACTLY FOUR AMINO ACIDS
LONG? (HINT: THERE ARE 20
POSSIBLE AMINO ACIDS.)
What are the sequences of all the possible tripeptides that contain the amino acids, serine, leucine and phenylalanine? Use 3-letter abbreviations to express your answer.
Draw a ribbon structure for the following polypeptide. There’s more than one answer to this question, make sure you are able to support your answer. Don’t have to write out the amino acids, just draw a line or ribbon, should include some numbers to indicate specific amino acids that you think will interact.
Chapter 1 Solutions
Concepts of Genetics (11th Edition)
Ch. 1 - Describe Mendels conclusions about how traits are...Ch. 1 - Review the Chapter Concepts list on p. 1. Most of...Ch. 1 - What is the chromosome theory of inheritance, and...Ch. 1 - Define genotype and phenotype. Describe how they...Ch. 1 - Given the state of knowledge at the time of the...Ch. 1 - Contrast chromosomes and genes.Ch. 1 - How is genetic information encoded in a DNA...Ch. 1 - Describe the central dogma of molecular genetics...Ch. 1 - How many different proteins, each with a unique...Ch. 1 - Outline the roles played by restriction enzymes...
Ch. 1 - What are some of the impacts of biotechnology on...Ch. 1 - Summarize the arguments for and against patenting...Ch. 1 - We all carry about 20,000 genes in our genome. So...Ch. 1 - How has the use of model organisms advanced our...Ch. 1 - If you knew that a devastating late-onset...Ch. 1 - Why do you think discoveries in genetics have been...Ch. 1 - The Age of Genetics was created by remarkable...Ch. 1 - Prob. 18PDQ
Additional Science Textbook Solutions
Find more solutions based on key concepts
Nursing Student with Neuropathic Pain
Tamara Costa broke her right tibia and has undergone two separate surger...
Human Anatomy & Physiology (11th Edition)
Define histology.
Fundamentals of Anatomy & Physiology (11th Edition)
1. Genetics affects many aspects of our lives. Identify three ways genetics affects your life or the life of a ...
Genetic Analysis: An Integrated Approach (3rd Edition)
How does trandlation differ from transcription?
Microbiology: Principles and Explorations
Match the people in column A to their contribution toward the advancement of microbiology, in column B. Column ...
Microbiology: An Introduction
What were the major microbiological interests of Martinus Beijerinck and Sergei Winogradsky? It can be said tha...
Brock Biology of Microorganisms (15th Edition)
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- A monomeric protein contains 154 amino acids. How many codons code for these amino acids? How many nucleotides?arrow_forwardHow many ways can four different amino acids be arranged in a peptide so that each peptide is unique?arrow_forwardMost proteins contain more than 100 amino acid residues. If you decided to synthesize a “100-mer,” with 20 different amino acids available for each position, how many different molecules could you make?arrow_forward
- You have discovered a novel protein that has a pl = 5.5. To study the functional properties of this new protein, your research group has made a mutant that contains two amino acid changes: a surface phenylalanine residue in the normal protein has been replaced by histidine (side chain pK, = 6.1), and a surface glutamine has been replaced by glutamic acid (side chain pK, = 6.0). Is the pl of the mutant protein predicted to be greater than, less than, or the same as the pI of normal protein? Support your answer with the appropriate calculation.arrow_forwardA researcher isolates a new protein and finds that it contains 0.755% serine by weight upon amino acid analysis. The molecular mass of serine is 105 g.mol-¹. What is the minimum molecular mass for the protein assuming only one Ser residue per protein molecule? mmin = The researcher estimates the molecular mass of the protein using gel electrophoresis. From this estimated molecular mass, the researcher concludes the protein contains 3 Ser residues. What is the estimated molecular mass of the protein as shown by gel electrophoresis? g.mol-¹ mest = g.mol-1arrow_forwardWhy is it no longer considered necessary to determine theN-terminal amino acid of a protein as a separate step?arrow_forward
- Suppose that there is a protein consisting of two polypeptide chains with the given sequences in the picture. Before performing Edman sequencing method, it is required to identify the protein's amino acid composition first. Explain why it is required to do the said step first before doing Edman sequencing method.arrow_forwardThere are a total of six different amino acid sequences for a tripeptide containing one molecule each of serine, valine, and glycine. Using three-letter abbreviations for the amino acids, draw the six possible sequences of amino acids.arrow_forwardHow many kilobases of the DNA strand below will code for the protein product?arrow_forward
- How many amino acids are in a 62 Angstrom long Alpha helix?arrow_forwardEach position of a codon can be occupied by one of four nucleotides. What is the minimum number of nucleotides per codon necessary to specify all 20 of the amino acids that are found in proteins?arrow_forwardYou are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280?? or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280??? Select the best answer. Measuring absorbance at higher wavelengths, like 595?? or 562??, is more accurate than measuring absorbance at…arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage Learning
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
QCE Biology: Introduction to Gene Expression; Author: Atomi;https://www.youtube.com/watch?v=a7hydUtCIJk;License: Standard YouTube License, CC-BY