Give reason which option is correct and give reasons why other options are incorrect. Note:Hand written solutions are strictly prohibited. Which nucleotide forms are used in the cellular reactionsfor DNA replication?a. 3' triphophatesb. 5' triphosphatesc. 2' diphosphatesd. 5' monophosphatese. 3' monophosphates

DNA replication is the process by which a new DNA molecule is synthesized using an already existing…

Answered: Which nucleotide forms are used in the…

Which nucleotide forms are used in the cellular reactions for DNA replication? a. 3' triphophates b. 5' triphosphates c. 2' diphosphates d. 5' monophosphates e. 3' monophosphates

BIOLOGY:CONCEPTS+APPL.(LOOSELEAF)

10th Edition

ISBN:9781305967359

Author:STARR

Publisher:STARR

Chapter8: Dna Structure And Function

Section: Chapter Questions

Problem 11SA: The phrase 5to3 refers to the _________ . a. timing of DNA replication b. directionality of DNA...

See similar textbooks

Related questions

Q: Amino acids project from each polypeptide backbone in a β-sheet in an alternating fashion (one above…

A: Based on affinity towards water, amino acids in given peptide can be grouped in following…

Q: Which of the following molecules' production is likely to be subject to feedback inhibition in a…

A: Tryptophan synthesis is typically regulated by feedback inhibition in bacteria. This process is…

Q: Determine whether each of the amino acids is polar, nonpolar, positively charged, or negatively…

A: Amino acids are biomolecules that have an amino group and a carboxyl group linked to the same carbon…

Q: Does RCSB PDB contain structural details of other biomolecules like nucleic acids, lipids, and…

A: RCSB PDB (Protein Data Bank) is a widely recognized and comprehensive repository for structural data…

Q: +H3N ** Select the most appropriate classification for the amino acid that is shown above. -…

A: Amino acids are biomolecules that have an amino group, a carboxyl group and a chemically diverse…

Q: In this chapter, we described co-immunoprecipitation as a method for identifying binding partners to…

A: Co-immunoprecipitation (Co-IP) is a laboratory technique used to identify and characterize…

Q: QUESTION : Enzymes can be regulated in a many different ways. Covalent modification is one way.…

A: Enzymes are protein-based biomolecules. They speed up chemical reactions. They take part in a…

Q: Why is the net charge 0 for cooh? Shouldn't it be +1?

A: Amino acids are biomolecules that have an amino group, a carboxyl group and a side group that is…

Q: A receptor-ligand complex has a dissociation constant of Kd = 20 nM. The rate of receptor-ligand…

A: The dissociation constant (Kd) for a receptor-ligand complex is related to the rate constants for…

Q: Classify the inhibitor characteristics according to one of three types of inhibition: reversible…

A: 1.Reversible NoncompetitiveCharacteristic: Inhibitor binds noncovalently at other than active…

Q: 1Need help:. draw valine-aminoacyl tRNA synthetase. Show the tRNAs and the valine amino acid. You…

A: A transfer RNA (tRNA) is a unique type of RNA molecule with the essential function of facilitating…

Q: In each case, these are enzymes that catalyze thesame reaction in different species. The question…

A: 1.Aminopeptidases (PR1A from mammal and PR1B from malaria parasite):First, obtain the…

Q: The process by which messenger RNA codes for the synthesis of a specific protein is called: a)…

A: The central dogma of molecular biology is a theory that states that the genetic information encoded…

Q: QUESTION 32 Which pair has similar chemical properties? O ¹H and 22 Na O 12C and 28gi O160 and 32

A: Atoms are the building blocks of matter, and the behavior of atoms in chemical reactions is…

Q: Calculate the equilibrium constant K for the isomerization of glucose-1-phosphate to…

A: ∆G0 of the given isomerization reaction is -5.61 KJ/molGiven temperature = 298 K Then what will be…

Q: Part A CaO can be used as a drying agent. One such application occurs when water is added to dry…

Q: You have not correctly determined what fraction of estrogen receptors is expected to be free in the…

A: Fractional saturation (Y) is the fraction of Receptors (R) that is bound by its Ligand (L). It can…

Q: Draw a diagram of the aspartic acid side chain in the protonated and unprotonated states. Calculate…

A: The four classes of biological macromolecules are proteins, nucleic acid, lipids and…

Q: Would you expect the pKa to be higher or lower than 8 if the group were buried in the hydrophobic…

A: PKa value is the measure of the tendency of a group to give up a proton. PK a is actually a…

Q: Which of the following functions describes the enzyme Peptidase? A. remove phosphate from a…

A: All living things depend on proteins in one way or another. The building components of peptides and…

Q: 2. A. If 100 mls of 0.03 M HCI is added to 400 mls of 0.5 M glycine buffer at pH 10.4, what is the…

A: The pH of our glycine buffer is 10.4. At this pH, it will be the alpha-amino group of glycine (that…

Q: 1. Major controls of de novo AMP synthesis include: 1. allosteric inhibition by GMP. 2. allosteric…

A: De novo AMP synthesis creates AMP. Ten enzymatic reactions make up the pathway. The PRPP and…

Q: 55. State characteristics or demographics of persons affects with Alzheimer's disease?

A: The progressive neurological disorder Alzheimer's disease affects cognition, memory, and behavior.…

Q: The results of a separation using two-dimension gel electrophoresis are shown here. Which protein or…

A: Two-dimensional gel electrophoresis is a technique used in proteomics studies.This technique is…

Q: Which class does the following enzyme belong to: GTP Hydrolases Lyases Ligases Transferases…

A: Enzymes are proteins that catalyze chemical reactions in living organisms. It is highly specific to…

Q: Determine whether each of the examples or phrases describes an essential amino acid, a nonessential…

A: Amino acids are the building blocks of proteins, which are essential molecules in living organisms.…

Q: Quest: 6. // Feedback on why I got it wrong. "At least one of the applications you have selected is…

A: Chromatography techniques are applied for the separation of macromolecules.These techniques are…

Q: The value of AGO for the conversion of 3-phosphoglycerate to 2-phosphoglycerate (2PG) is +4.40…

Q: added ligand concentration of 10 µM is 5 × 10° s k_1 = 1 ×10-4 Incorrect What is the value of the…

A: Consider the interaction between a ligand (L) and its receptor (R), as shown below.R + L RLHere,…

Q: Choose any/all that apply to protein synthesis. Ribosomes aid in the formation of peptide bonds…

A: As per the central dogma of molecular biology, genetic information for protein synthesis is stored…

Q: Explain why unfolding or aggregation may occur using changes in entropy and enthalpy of the protein…

A: Adding a small amount of salt into a protein solution can increase the solubility of the protein in…

Q: What is the total mass of oxygen in a single molecule of glucose? Express your answer in amu to 5…

A: Glucose is a carbohydrate, a monosaccharide. In most living cells, glucose is oxidised completely…

Q: Answer the following problem and show your detailed solution and explanation. Cysteine is a…

A: 1.Titration of the Amino Group:The amino group (-NH2) in cysteine has a pKa around 9, so it will be…

Q: Which of the reactions are spontaneous (favorable)? L-malate + NAD+ oxaloacetate + NADH + H+ AG =…

A: Gibbs free energy change (ΔG) is a thermodynamic quantity that represents the maximum reversible…

Q: The amide hydrogen atoms of peptide bonds within proteins can exchange with protons in a solvent. In…

A: Hydrogen-deuterium exchange (HDX) is a technique that can be used to study the structure and…

Q: Which of the following can be directly influenced by activated G-proteins after a GPCR is activated?…

A: G Protein Coupled receptors are also called metabotropic receptors or heptahelical…

Q: Sickle cell anemia patients suffer from a distorted red blood cell shape and an anemic condition as…

A: d. In sickle cell anemia patients, 100% of the hemoglobin assembled contains the mutant β globin,…

Q: Calculate either [H3O+] or [OH-] for each of the solutions at 25 °C. Solution A: [OH¯] = 1.43 × 10¯7…

A: To calculate [H3O+] and [OH-] for each of the solutions, we can use the equation for the ion product…

Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…

A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…

Q: 1 a- What is the approximate length of a DNA molecule (in the B form) containing 10,000 base pairs?…

A: The approximate length of a DNA molecule containing 10,000 base pairs can be calculated by using the…

Q: H CH₂ HỎ=CH. CH₂ H₂C (5) H CH₂ H₂C CH₂ CH₂ CH₂ ΝΗ C=NH NH₂ a) Which of the following statements…

A: Recall that:amino acid sequences are written with N-terminal amino acid on the left and C-terminal…

Q: Among the given organelles, which ones are present or prominent in plant cells but not in animal…

A: Lysosomes;- are present in the cell of animal and they are responsible for breaking down waste and…

Q: The following reaction is catalyzed by this type of enzyme? COO™ COO™ HIC-H HIC-H COO™ succinate…

A: The conversion of succinate to fumarate is an important step in the citric acid cycle (also known as…

Q: For each amino acid, show the structure, 1-letter abbreviation, 3-letter abbreviation, class…

A: Amino acids are organic compounds that contain both amino and carboxylic acid groups. Amino acids…

Q: Part C If, in addition to the constraints on glucose concentration listed previously, we have in the…

A: Pi + Glucose -> Glucose-6-Phosphate + H2OFor the above reaction, ΔG°’ = + 13.8 kJ/mol and…

Q: Classify each peptide chain as part of a parallel β sheet, part of an antiparallel β sheet, either…

A: Beta-sheets are one of the most common secondary structures seen within proteins. Several…

Q: EXPLAIN WHY THE DIRECTION OF MOVEMENT OF FLUID IN THE MANOMETER WAS DIFFERENT DURING YEAST…

A: A manometer measures pressure differences in fluid-filled systems. You seem to be asking about…

Q: Indicate what will happen ( increase, decrease or no effect) a. release of glucagon in the blood to…

A: Hormones can be described as chemical messengers. Hormones are synthesized by glands and…

Q: Which of the following best describes how the large and branched side chains are organized within a…

A: Beta-sheets are one of the most common regular secondary structures seen in proteins. The…

Q: The following is a segment of the primary structure of an α-helix: N terminus.......– amino acid 1…

Question

Give reason which option is correct and give reasons why other options are incorrect. Note:Hand written solutions are strictly prohibited.

Which nucleotide forms are used in the cellular reactions
for DNA replication?
a. 3' triphophates
b. 5' triphosphates
c. 2' diphosphates
d. 5' monophosphates
e. 3' monophosphates

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1: DNA replication

VIEW

Step 2: 5' triphosphates are used in the cellular reactions for DNA replication

VIEW

Step 3: Why the other options are incorrect ?

VIEW

Solution

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 4 steps with 6 images

SEE SOLUTION Check out a sample Q&A here

Similar questions

Match each nucleobase to its corresponding pair. 1. pairs with cytosine 2. pairs with guanine 3. pairs with adenine 4. pairs with thymine a. cytosine b. adenine c. thymine d. guanine
Which molecule provides the energy for the assembly of new nucleotides into a DNA strand during DNA replication? a. ATP b. the nucleotide itself c. NADH d. primers e. DNA ligase
Write the sequence of the complementary strand of each segment of a DNA molecule. a. 5 '–AAATAAC–3 'b. 5 '–ACTGGACT–3 'c. 5 '–CGATATCCCG–3 'd. 5 '–TTCCCGGGATA–3
Which dna strand will be synthesized continuously during dna replication? a.The strand that is synthesized as Okazki Fragments b.the strand which is synthesized in the opposite direction compared to the direction of DNA unwinding? c.the strand which is sythesized in the same direction as the same direction of DNA unwinding? d.The m-RNA like strand e. The non-template strand
The α-helix and the β-pleated sheet are part of whichprotein structure?a. primaryb. secondaryc. tertiaryd. quaternary
Consider the following segment of DNA: 5 ATGTGG C T T GAT T T T CA AG C TA CAC C G A ACT A A A AG T T C G G GT GATA AT T CACTATTA A
Which describes the role of primase during replication? It catalyzes the formation of phosphodiester bonds using NTPs as substrates. It coordinates synthesis of the leading strand and the lagging strand. It functions as a holoenzyme that polymerizes in the 3’→ 5’ direction. It uses an exonuclease activity to remove incorrect nucleotides.
During DNA replication, what is the very first process to occur? a. synthesis of the lagging strand b. sealing of the nicks between short DNA sections c. synthesis of the leading strand d. identifying where to start or "initiate" replication e. unwinding of the parent DNA
Match each DNA component to its corresponding point of attachment. 1. carbon 3' 2. carbon 5' 3. carbon 1' a. neighboring nucleotide b. nitrogen base c. phosphate group
In a DNA strand the nucleotides are linked togther by?
justify the statement in a short: Multiplication of viroids cycles between both monomeric and multimeric versions of RNA molecules
Make a list of all components necessary for DNA replication; now explain how these components are used.