What is the Rf value of each amino acid sample?Arrange the amino acids from most polar to least polar. 1.) Five amino acids were subjected to paper chromatography, using a less polar solvent as the mobilephase. After visualization using ninhydrin, the distance travelled by the amino acids were measuredas follows:Distances:ASolvent - 7.5cmA - 6.8cmBВ - 5.7сmC - 0.4cmED - 1.2cmE - 0.8cma.) What is the Rf value of each amino acid sample?b.) Arrange the amino acids from most polar to least polar.

Paper chromatography: It is a method of separating and identifying both color and colorless…

Answered: What is the Rf value of each amino acid…

Science

Biochemistry

What is the Rf value of each amino acid sample? Arrange the amino acids from most polar to least polar.

Biochemistry

9th Edition

ISBN:9781319114671

Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Chapter1: Biochemistry: An Evolving Science

Section: Chapter Questions

Problem 1P

See similar textbooks

Related questions

Q: If the target protein is 0.1% of the total protein in the original mixture, a three-step…

A: Purification is a process by which impurities are removed from a sample and desired component is…

Q: We're attempting to isolate and purify a single protein. Gel filtration chromatography columns allow…

A: Answer: CHROMATOGRAPHY : It is the technique used to isolate the molecules depending upon their size…

Q: Leni, Isko and Ping are trying to determine the molecular weight of their crude protein samples…

A: SDS-PAGE (sodium dodecyl sulphate–polyacrylamide gel electrophoresis), is a discontinuous…

Q: In order to prepare a standard curve, you will do serial dilutions of the standard protein. Assume…

A: Serial dilutionsIt refers to the stepwise dilution of a solution to create a series of solutions…

Q: Explain in details how you could separate a mixture of three amino acids Arg, Lys, and Cys using…

A: In order to separate Arginine , lysine and cysteine using ion-exchange chromatography we will use…

Q: How can I calculate the molecular weight of the unknown protein on this sample using the SDS-PAGE…

A: Electrophoresis of proteins is generally carried out in gels made up of the cross linked polymer…

Q: Given a stock protein solution with a concentration of 3 mg/ml, determine the protein concentration…

A: Stock solutions are used in many laboratory procedures, in order to save space for keeping larger…

Q: For each of the following denaturing agents, explain the changes that you observed when each of them…

A: Egg white contains a high level of protein. Denaturation is the process in which protein loses its…

Q: In making the experiment of protein denaturation, what usually happens upon, precipitation of strong…

A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…

Q: Define a chaotropic agent. What effect would a chaotropic agent have on protein structure?

A: Introduction :- Chaotropic agents are cosolutes that have the potential to damage the network of…

Q: 80 20 60 0 60 20

A: It is a way to visualise angles as a function of angles . It is the way we could identify the…

Q: How many amino acids are present in this peptide? فيكم A) 6 B) 7 C) 8 D) 9

A: We have to determine the number of amino acids present in the structure below:

Q: It is necessary to develop a string matching method that may be used to compare two or more…

A: To determine patterns over sequences and to determine different matching pattern we use string…

Q: Can someone give me examples of denatured proteins that can be brought back to native state…

A: The question asks the examples of denatured protein which can be transformed into the renatured or…

Q: Acid hydrolyses of proteins is often used to determine the amino acid composition of a protein.…

A: Proteins are made up of small units or building blocks. These units are called amino acids.…

Q: Describe the process used in purification of protein

A: Proteins are larger biomolecules that are made up of a combination of 20 different amino acids, and…

Q: This is a picture of an SDS-PAGE gel. In the left lane are protein standards with molecular masses…

A: SDS-PAGE is used determining the molecular weight (MW) of an unknown protein. The first step the…

Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…

A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…

Q: You are working in the lab with a polypeptide that is present in solution at 1 mg/mL. The…

A: Molarity (M) is the amount of a substance in a certain volume of solution. Molarity is defined as…

Q: Give other chromatographic techniques that can be used for separating non-polar biomolecules, such…

A: Introduction: Chromatography is a method for separating a mixture in the laboratory. The mixture is…

Q: HOW MANY of the following five items represent modes of protein denaturation? 1.) heating a protein…

A: Proteins are biomolecules composed of amino acids. Amino acids are joined together through peptide…

Q: In isoelectric focusing, a protein sample is applied at the end of a gel with an immobilized pH…

A: In isoelectric focusing, a protein sample is applied at the end of a gel with an immobilized pH…

Q: What protein purification methods can be used to ensure that the resulting protein is soluble ?

A: The method used for protein purification that can be used to ensure that the resulting protein is…

Q: Look at the amino acid composition of a protein given in the table and click on the area in the 2D…

A: the isoelectric point of an amino acid is the pH at which the net electric charge of that amino acid…

Q: Look at the amino acid composition of a protein given in the table and click on the area in the 2D…

A: the isoelectric point of an amino acid is the pH at which the net electric charge of that amino acid…

Q: When given a purification table that contains the total protein, protein conc., the specific…

A: Proteins are purified by using different chromatography techniques such as hydrophobic interaction…

Q: What other approaches can be used to determine protein concentration?

A: Introduction : Proteins are nitrogenous organic substances made up of one or more elongated chains…

Q: Compare and contrast the following protein characterization techniques in terms of the principles…

A: Different types of chromatography can be used to purify and characterize proteins. In…

Q: Mass spectrometry and X‑ray diffraction are common biochemical techniques for characterizing…

A: In order to determine the mass-to-charge ratio (m/z) of one or more molecules found in a sample,…

Q: Find a method that uses some form of HPLC for the analysis of proteins. What was the stationary…

A: Protein analysis by chromatography is a widely used technique for separating, identifying, and…

Q: What is specific activity and how is it useful in protein purification'

A: Proteins are made up of amino acids linked by peptide bonds. Pure form of proteins can be obtained…

Q: The overall, net ionic charge on this peptide at pH = 7 would be: Cys-Ala-Glu-Arg-Met-Ser +2 -1 +1 O

A: Organic substances with both amino and carboxylic acid functional groups are called amino…

Q: How can you separate and identify Molecular weight of target protein from a protein sample?

A: Proteins are composed of amino acids. Different amino acids have different molecular weight. So,…

Q: What are some advantages of sequencing peptides by mass spectrometry rather than by Edman…

A: Edman degradation: It is a three-stage reaction that tags and removes the N-terminal residue of a…

Q: How do you separate proteins using SDS-PAGE?

A: Protein is a class of biomolecules that are regarded as the most essential component of life in…

Q: Can native gel electrophoresis of protiens be used to determine protein molecular weight? Explain.

A: Electrophoresis is the motion of dispersed particles relative to a fluid under the influence of a…

Q: Predict the amino acid sequence based on the conditions below. Use the one-letter abbreviation of…

A: Amino acids are building block of polypeptide chain. its alpha carbon contains carboxyl group, amine…

Q: Provide examples of amino acids that would yield a positive Azo Dye test and amino acids that would…

A: The azo dye test is used to identify the presence of amino acids that contain the aromatic ring.…

Q: GC-MS can be used to separate and identify proteins, and HPLC is commonly used to separate lipids…

A: GC-MS can be used to separate and identify proteins, and HPLC is commonly used to separate lipids it…

Q: Discuss about Amino Acid Analysis ?

A: The amino acids were considered the organic compounds that form the building blocks of protein.…

Q: You were able to extract an amino acid sequence from an unknown protein you process through mass…

A: An analytical tool that is used for the purpose of measuring the ratio of mass-to-charge, is called:…

Question

What is the Rf value of each amino acid sample?
Arrange the amino acids from most polar to least polar.

1.) Five amino acids were subjected to paper chromatography, using a less polar solvent as the mobile
phase. After visualization using ninhydrin, the distance travelled by the amino acids were measured
as follows:
Distances:
A
Solvent - 7.5cm
A - 6.8cm
B
В - 5.7сm
C - 0.4cm
E
D - 1.2cm
E - 0.8cm
a.) What is the Rf value of each amino acid sample?
b.) Arrange the amino acids from most polar to least polar.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Similar questions

Can you recommend the most suitable method for purification of peptides in acidic solution (pH<2)?
Draw the schematic diagram of the protein purification through hydrophobic column chromatography and explain the purpose of each step.
Which of the following base change will result in the alteration of the net charge of the amino acid at pH 7.0? GAA ->TAG GTA -> TTC СTG -> СТС CCG -> CGC TTC -> GCA
What is the essence of conducting protein extraction procedures in the field of Biology Note: Provide an answer with 100-200 words
You're on duty at a prominent Metro laboratory. You mixed up a sample for protein analysis of the samples needed for forensic examination that contains pure DNA while waiting for your closest friend. You decided to use the knowledge you gained in Biochemistry to run the combined samples through a spectrophotometer to eliminate contaminated protein. Determine which of the samples should be extracted and separated for protein analysis based on the following data. Show all of your solutions. A230 A260 A280 Buffer 0.051 0.091 0.065 Sample A 1.27 4.54 2.01 Sample B 1.32 3.92 2.11 Sample C 1.95 3.88 2.04 Sample D 1.44 4.21 2.32
When performing a separation by ion-exchange chromatography, the rate of elution of an amino acid is influenced by three main factors: a. Temperature b. Solution (buffer) pH c. Ionic strength (buffer concentration) of the eluent Briefly, explain how each of these parameters influences elution rate. Please provide only typed answer solution no handwritten solution needed allowed
Which technique is used to identify an unknown protein ?
How would a copper bowl effect the denaturation of the proteins when mixed?
When separating proteins from cellular extractions, what electrophoresis method works best and what protein characteristics need to be taken into account that are not a problem for nucleic acid-based molecule? Describe the process and in your answer.
How is PAGE (Polyacrylamide Gel Electrophoresis) different from other protein purification techniques?
Explain the Rf value obtained on the basis of the structure of amino acids use. Explain in 1-3 sentence only.