Parallel and anti-parallel beta sheets are found in proteins, but more often the latter. This is because: a. Hydrogen bonds are intermolecular in parallel, vs intramolecular for anti-parallel b. Hydrophobic interactions are the primary mode of stabilization in anti-parallel. c. The hydrogen bonding pattern is different in anti-parallel, and more directionally stabilized than parallel. d. Parallel beta sheets are only found in membrane proteins. e. None of the above 22. Which of the following is most likely to destabilize a beta sheet? A. Leu B. Asn C. Pro D. Ser E. Ala 23. lon exchange chromatography separates proteins based on a. pH b. mass c. charge d. hydrophobicity e. none of the above 24. Four proteins, 1 (MW 30,000), 2 (MW 275,000), 3 (MW 10,000) and 4 (MW 55,000) are separated by gel filtration chromatography. The order of elution from the column will be: a. 1, 2, 3, 4 b. 2, 1,4,3 c. 3,1,4,2 d. 2,4,1,3 e. 2,1,3,4 25. Four proteins, 1 (pl 5), 2 (pl 9.8), 3 (pl 7) and 4 (pl 5.7) are purified using cation exchange chromatography. What is the order of elution from the column using a salt gradient? a. 1, 4, 3, 2 b. 2,3,4,1 c. 3,1,4,2 d. 2,4,1,3 2,1,3,4

Parallel and anti-parallel beta sheets are found in proteins, but more often the latter. This is because: a. Hydrogen bonds are intermolecular in parallel, vs intramolecular for anti-parallel b. Hydrophobic interactions are the primary mode of stabilization in anti-parallel. c. The hydrogen bonding pattern is different in anti-parallel, and more directionally stabilized than parallel. d. Parallel beta sheets are only found in membrane proteins. e. None of the above 22. Which of the following is most likely to destabilize a beta sheet? A. Leu B. Asn C. Pro D. Ser E. Ala 23. lon exchange chromatography separates proteins based on a. pH b. mass c. charge d. hydrophobicity e. none of the above 24. Four proteins, 1 (MW 30,000), 2 (MW 275,000), 3 (MW 10,000) and 4 (MW 55,000) are separated by gel filtration chromatography. The order of elution from the column will be: a. 1, 2, 3, 4 b. 2, 1,4,3 c. 3,1,4,2 d. 2,4,1,3 e. 2,1,3,4 25. Four proteins, 1 (pl 5), 2 (pl 9.8), 3 (pl 7) and 4 (pl 5.7) are purified using cation exchange chromatography. What is the order of elution from the column using a salt gradient? a. 1, 4, 3, 2 b. 2,3,4,1 c. 3,1,4,2 d. 2,4,1,3 2,1,3,4

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Related questions

Q: Which of the following pairs of amino acids are likely to form hydrophobic interactions between…

A: The objective was to determine the pairs of amino acids that are likely to show hydrophobic…

Q: a.) c.) H₂N H₂N OH -OH OH _OH b.) d.) H₂N H₂N ОН OH OH

A: The question is based on the concept of amino acids. We need to identify the amino acid which…

Q: 1. What type of interaction would you expect between the R groups, lysine and aspartic acid, in…

A: We have to identify the interaction present in lysine and aspartic acid R groups

Q: 5 ased on molecular weights of purified (no beta-Me) and (beta-Me) sample, which are 97.4 kDa and…

A: Given , molecular weight of (no beta -Me ) purified sample = 97.4 kDa molecular weight of (beta -Me)…

Q: nge in the voltage of a cell membrane causes all the voltage-gated Nat channels to open, the…

A: If there is a change in a cell's membrane potential a message in the form of an electrical impulse…

Q: 1. Please describee (1) Type I B-Turn and (2) Type II B-Turn in detail. 2. Please show a protein…

A: Understanding the three-dimensional structure of proteins is fundamental to unraveling their…

Q: Which of the following reagents is most likely to promote the denaturation of proteins? a. sodium…

A: We are to discuss whoch of the two reagents, sodium dodecyl sulfate or imidazole is most likely to…

Q: 8. The following proteins represent a wide range of molecular weights and isoelectric points. Mr is…

Q: a. Explain why the presence of certain proteins in body fluids such as urine or blood can indicate…

A: a. A group of amino acids combining together to form various molecules are called proteins. They are…

Q: For ach of the following representations (from OpenStax Biology), indicate whether it is describing…

A: We have to tell the given representation describes whether the primary, secondary or tertiary…

Q: Draw the tripeptide Alanine-Cysteine-Serine (R1 = CH3, R2 = CH2SH, R3 = CH2OH) under the following…

A: The structure of tripeptide Alanine-Cysteine -Serine is shown in the below steps at different pH, At…

Q: 10. Which side chain would most likely be found in the interior of a protein, away from the aqueous…

A: The correct option is (e). Reason for the correct option: In…

Q: 27. Which of the following is a biological function of proteins? a. catalysis Ob. motion Oc.…

A: proteins catalyse reactions in our bodies, transport molecules like oxygen and keep us healthy as…

Q: VII. Write the following Amino acid as, a. polar/non-polar%; b. Neutral/acidic/basic c. Also write…

A: The given amino acid is proline. The proline amino acid contains a carboxylic acid and a secondary…

Q: 13. How many amino acids are required in a B-bend? A) 3 B) 3.6 C) 4 D) 5 14. Which one of the…

A: These questions touch on essential concepts in biochemistry, molecular biology, and protein science,…

Q: Some proteins owe their functions to the three dimensional shape they have; what contributes to…

A: using basics of 3D structure of protein.

Q: This results in fats that melt over a fairly broad temperature range as the solids transition to…

A: A multiple choice question based on properties of fats, which is to be accomplished.

Q: The following sequence is part of a globular protein. Predict the secondarystructure in this region.…

A: There are two secondary structures: 1. Alpha Helix 2. Beta sheets RRPVVLMAACLRPVVFITYGDGGTYYHWYH…

Q: 2. a. Which amino acid is this? (might need to look at another amino acid b. Label which of these is…

Q: Use this image to answer the following questions A HC HO OH NH NH Он D HO, NH. HO HC CH 4. O- HO OH…

A: Carbohydrates have an aldehyde or ketone and a alcohol group as functional group .In case of…

Q: What is the major force responsible for the formation of an a-helix in protein secondary structure?…

A: In this question, we will see which force is responsible for making alpha helix in secondary…

Q: Which amino acid might be expected to have the LEAST effect on the function of an enzyme if it…

A: The amino acids which shows less effect when it replaced with arg residue is given below.

Q: Identify the name of the amino acid and classify it based on: a. chirality b. configuration c.…

A: The name of the amino acid is Glutamic acid.

Q: protein has a number of aspartyl and gluatmyl residues, what would be the expected pI for this…

A: Answer The protein has number of aspartyl and glutamic…

Q: 13. Which of the following types of interactions result in proteins folding so that nonpolar…

A: EXPLANATION: What is protein folding? Protein folding is the physical process by which a protein…

Q: Imagine the main chain of a protein bends back on itself, so that two amino acid residues R₁ and R₂…

A: Sure, let's delve into each interaction:1. Valine - Alanine (Hydrophobic Interaction): Both valine…

Q: In the secondary structure of proteins, we cannot see: a. pleated sheet b. double helix c. random…

A: The objective of the question is to identify the correct option.

Concept explainers

Spectroanalytical Methods

Spectroanalytical methods measure the wavelength and intensity of radiations that are either emitted or absorbed by a molecular or atomic species. These methods are useful for evaluating the electronic or atomic arrangement of the molecules of a given analyte.

Question

100%

Parallel and anti-parallel beta sheets are found in proteins, but more often the latter. This is
because:
a. Hydrogen bonds are intermolecular in parallel, vs intramolecular for anti-parallel
b. Hydrophobic interactions are the primary mode of stabilization in anti-parallel.
c. The hydrogen bonding pattern is different in anti-parallel, and more directionally
stabilized than parallel.
d. Parallel beta sheets are only found in membrane proteins.
e. None of the above
22. Which of the following is most likely to destabilize a beta sheet?
A. Leu
B. Asn
C. Pro
D. Ser
E. Ala
23. lon exchange chromatography separates proteins based on
a. pH
b. mass
c. charge
d. hydrophobicity
e. none of the above
24. Four proteins, 1 (MW 30,000), 2 (MW 275,000), 3 (MW 10,000) and 4 (MW 55,000) are
separated by gel filtration chromatography. The order of elution from the column will be:
a. 1, 2, 3, 4
b. 2, 1,4,3
c. 3,1,4,2
d. 2,4,1,3
e. 2,1,3,4
25. Four proteins, 1 (pl 5), 2 (pl 9.8), 3 (pl 7) and 4 (pl 5.7) are purified using cation exchange
chromatography. What is the order of elution from the column using a salt gradient?
a. 1, 4, 3, 2
b. 2,3,4,1
c. 3,1,4,2
d. 2,4,1,3
2,1,3,4

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

Step 2

Step 3

Step 4

Trending now

This is a popular solution!

Step by step

Solved in 4 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

Which factors will cause protein denaturation? Select all that apply. a. aqueous phosphate buffer b. organic solvents c. changes in temperature d. small metal ions - Na+, Ca2+, Cl- e. Tris a buffer commonly used with proteins f. heavy metals - Hg2+, Pb2+, Ag+
Determine the type of stereoisomer the following amino acid is. HI!!! 000 A. This is a D-amino acid. This is also a R-atnino acid. B. This is a L-amino acid. This is also a R- anuno acid. C. This is a D- amino acid. This is also a S-amino acid. x D. This is a L-amino acid. This is also a S-amino acid.
A protein has a chain of 200 amino acids. This is the protein's ________ structure a. primary b. secondary c. tertiary d. quaternary The secondary structure of proteins results primarily from which of the following interactions? a. formation of disulfide linkages b. formation of hydrogen bonds c. formation of salt bridges d. more than one response is correct e. no correct response Protein denaturation results in a disruption of the a. primary structure b. secondary and tertiary structure c. primary and secondary structure d. primary, secondary and tertiary structure e. no correct response is given H2 + CH2 = CH2 --> CH3CH3Which of the following could be a substrate for an enzyme that has an induced-fit active site and catalyzes the reaction above? a. CH3_OH b. CH2=CH_CH3 c. CH3_O_CH2CH3 d. none of the above Enzyme activity is best determined by performing a(n) a. enzyme international unit b. enzyme efficiency test c. enzyme specificity test d. enzyme assay
1. Determine whether each of the following statements describes the primary, secondary, tertiary, or quaternary stucture of a protein. а. Peptide bonds join amino acids in a polypeptide chain. b. Two polypeptide chains are held together by hydrogen bonds. С. Hydrogen bonds form between adjacent segments of the backbone of the same protein to form a "folded fan" structure. 2. List the type of denaturing agent described by the following treatments: a. disrupting the disulfide bonds in hair to straighten it b. baking the proteins in dough to make bread
Amino Acids and Proteins 1. What are the structural features of amino acids with an emphasis on essential amino acids? 2. Write the properties of amino acids: zwitterion, pka, pKb, amphoteric character, isoelectric point, and electrophoresis. 3. Write the mechanism of peptide bond formation and what are its structural features. 4. What are the different types of proteins and their function? 5. Explain the meaning and importance of the primary, secondary, tertiary, and quaternary structures of a protein and the factors that cause its denaturation.
Which of these amino acids has a hydrophobic side chain?
Please don't provide handwritten solution .....
28. The terms "fibrous" and "globular" are used to classify proteins in terms of their a. function b. composition C. shape d. regulation
5