Q: Structure Prokaryotic Animal Plant cells cells cells nucleus Cell wall Mitochond ria Chloroplast
A: 1) Prokaryotic cells- NUCLEUS- ABSENT CELL WALL- PRESENT MITOCHONDRIA- ABSENT CHLOROPLAST- ABSENT 2)…
Q: All cells have a cell wall but only plant cells have a cell membrane.
A: Ans- False, As eukaryotic cells don't have cell walls. Plant cells do have cell walls along with…
Q: Ribosome Endoplasmic reticulum Golgi apparatus Cell wall Vacuoles Lysosomes Mitochondria Cell…
A: Plant and animal both have cells as their structural and functional unit. Both plant and animal…
Q: Which of the following is not found in a prokaryotic cell?a. Plasma membraneb. Ribosomec. Cell…
A: The cells are the primary unit of life. Unicellular organisms lack the cellular organelles like…
Q: Plant and Animals have similar cellula Chloroplast ANIMAL Cytoskeleton BOTH Central Vacuole PLANT…
A: Cell is a basic structural and functional unit in both plants and animals. Both animal and plant…
Q: This organelle takes glucose and turns it in to energy (ATP) O ribosomes O mitochondria O cell wall…
A: Eukaryotic cell is characterized by having membrane bound nucleus and cell organelles like…
Q: Which cell structure responsible for energy transformer Lysosomes Endoplasmic reticulum Mitochondria…
A: Ans 1: mitochondrion Mitochondria. A mitochondrion (plural = mitochondria) is a membranous,…
Q: Draw the table and fill in the blanks by matching the cell structure to the function. Lipid-bilayer…
A: A cell is the structural and functional unit of life. There are various components present inside…
Q: Match the organelles with the proper description: Nucleus Membrane-bound sit of protein production…
A: Cell organelles are structures that are found inside the cell that perform different cellular…
Q: DNA is not found in this organelle. a. Endoplasmic reticulum b. Nucleus c. Chloroplast d.…
A: A gene is a fundamental unit of heredity and a grouping of nucleotides in DNA or RNA that encodes…
Q: Which of the following organelles contains no DNA?a. nucleus c. mitochondrionb. Golgi body d.…
A: The cell is the basic structural and functional unit of life. It carries out various functions in…
Q: Which of the following is not a double ?membrane-bound organelle Endoplasmic Reticulum Chloroplast O…
A: Organelles: Organelles are classified into three categories based on the presence or availability of…
Q: Choose the TWO organelles in the list balow that are found in only plant cells cell membrane A cell…
A: The biological level of the organization is a hierarchy that represents the arrangement of living…
Q: Where in a cell does most ATP production take place mitochondria lysosomes nucleus cell wall
A: Ans- Mitochondria
Q: A student is examining a stained animal cheek cell using a light microscope. Which cell structure is…
A: A microscope is an instrument used to observe minute objects normally not visible to the naked eyes.…
Q: After each description, fill in the appropriate structure: “powerhouses” of the cell:_______ ;…
A: Fill in the blanks
Q: Eukaryotic cells are more complex than prokaryotic cells. Which of the following are found only in a…
A: Eukaryotic cells are large cells with size that ranges from 10-100 micrometers while prokaryotic…
Q: GOLGI BODIES ORGANELLES VACUOLE START PASSAGEWAYS IN THE CELL THAT CARRY A TYPE OF CELL THAT HAS A…
A: The correct matching of cards with explanation is done. The numbers or symbols in red is not…
Q: The Golgi Apparatus is part of which of the following? extracellular matrix electron transport chain…
A: The Golgi apparatus is an organelle found in Eukaryotic cells. The primary function is to process…
Q: Photosynthesis uses light in what spectrum? O infrared (700 nm â 1 mm) ultra-violet (10 nm â 400 nm)…
A: Endoplasmic reticulum- It is a vast network of membrane - bound closed tubes and sheets that run…
Q: CELL MEMBRANE MITOCHONDRIA NUCLEUS CYTOPLASM CHLOROPLAST VACUOLE
A: Cell is a structural and functional unit of living organisms. Several cells joined together to form…
Q: peroxisome nuclear pore chloroplast nucleus smooth ER nucleolus microfilament ribosome Golgi…
A: INTRODUCTION Cell is a basic functional unit of life system. Cell is mainly a…
Q: Cell Membrane Nucleus Mitochondria Vacuole Cell Wall Cytoplasm Chloroplast Lysosome 2. 6. 8. 5. 4.…
A: The animal cell and the plant cell has been labelled as follows-
Q: PLANT, ANIMAL, FUNCTION PICTURE or BOTH? ORGANELLE
A: Cell organelles are cellular bodies of a cell, that are the machinery of a cell. These organelles…
Q: The organelle shown is used by plants to carry out photosynthesis. What is the name of the…
A: The living, self replicating, structural and functional unit of all living organisms is called cell.…
Q: digestion and waste removal(has enzymes in it) Does photosynthesis Light+water+CO2-> glucose+02…
A: A lysosome is a membrane bound cell organelle which contains hydrolytic enzymes within it. They are…
Q: cell that is actively fighting bacteria would have a high number of: Lysosomes Chloroplasts…
A: Introduction: A cell adheres to the item it wishes to engulf on its surface during phagocytosis,…
Q: This organelle allows molecules to enter and leave the cell. Also, supports and protects the cell O…
A: Biology is a branch of science. Bio means life and ology means study. Biology is basically the study…
Q: All of the following cellular structures have their own genetic material EXCEPT: A. Mitochondrion B.…
A: As per the guidelines, we are supposed to answer only the first question in case of multiple…
Q: Which of the following consist of protoplasm?A. Nucleus + cytoplasm B.…
A: The cell can be defined as the basic functional and the structural unit of the organism. Cellular…
Q: In which of the following are most of the organelles in eukaryotic cell found? a.cell membrane…
A:
Q: Which of the following statements is true about the Nucleus cell organelles? . Nucleus is not…
A: 1. Prokaryotes are unicellular organisms that lack membrane-bound structures, the most noteworthy of…
Q: DNA is found coiled up into chromosomes within what cellular structure/organelle? O mitochondria O…
A:
Q: Comparison of animal cell and plant cell Animal cell Plant cell Similarities Shape Cell wall…
A: Even though the number, type, function, and sizes of the cells differ, cells are the basic unit of…
Q: In which part of a cell does the process of making ATP from oxygen and glucose take place? A.…
A: During aerobic cellular respiration, glucose interacts with oxygen to generate ATP, which the cell…
Q: Which of the following organelles produces and modifies polysaccharides that will be secreted by a…
A: Prokaryotes are unicellular organisms that lack membrane bound organelles. They are of two types;…
Q: Which organelle functions to modify and package proteins for transport outside of the cell? O Golgi…
A: Answer is Golgi apparatus The Golgi apparatus is a large organelle that processes proteins and…
Q: Some cells, such as muscle cells, need a high supply of energy. What organelle woulc you expect to…
A: Organelles are subcellular structures found in a cell that has specific function to perform. There…
Q: The nucleus and mitochondria share which of the following features?a. protein-lined membrane poresb.…
A: Cell organelle is a particular element present inside a specific type of cell that plays out a…
Q: Which of the following pairs is mismatched? cell membrane/lipid bilayer O nucleolus/ribosomal RNA…
A: Following I will be discussing about the given pairs and which among them is mismatched. Lysosome…
Q: Match the organelle to its job chloroplast [ Choose ] [Choose ] gets energy from food houses the DNA…
A: Answer. Chloroplast - Makes Food. Plants leave consist of numerous chloroplasts which capture the…
Q: Which of the following organelles most closely resembles a prokaryotic cell? O cell wall…
A: Introduction A single-celled creature without a nucleus and other membrane-bound organelles is known…
Q: caplule flagelium Cell wall cytoskeleton ribosomes nucleoid cytoplasm
A: A microorganism that can only be seen under a microscope. Bacteria, protozoa, algae, and fungi are…
Q: Which organelle is common in animal and plant cel
A: A cell is a structural and functional unit of all living organisms. Cells differs among prokaryotes…
Q: Cell Part Cell City Cell Membrane/Cell Wall (plant cells only) City Border Cytoplasm Nucleus City…
A: Cell A cell is the basic structure of a life form. many cells combine into firm tissues which…
Step by step
Solved in 2 steps
- Final Assessment for Exploring M X forms/d/e/1FAIpQLSe8RrfvHEr59pISGjbEneL041GxKTvyw9-Xc_EA7Um_8xqReA/viewform?hr_submission-Chg1990yzQ8SEAjwvY285... First mRNA base (5) end of codon) A Sequence C Sequence D 5. A DNA sequence of "ACG" will code for the amino acid UUG CUC CUA CUG wh GUC GJA GUG Cys 100 AUU AUC lle ACC AUA ACA AUG MACG] Val M Second mRNA base UCA UCG The GCU GCC.. GCA GIGA CAA CAG Tyr UAC UGC UAA Stop UGA Stop A UAG Stop UGG Tro AAU AAC MT AAC GAC GAG 2 Lys Asp CGA CGG AGU AGC AGA AGG Lys GGU GGC GGA GGG Arg DUAU Gly C Third mRNA base (3' end of codon) Lys (K) DELL C GU A C DEOTOCCAGUCAGUCAGUCHOSOTOS M G (F) A (LS1-1) * GU A C CUGA OPCUGACU GACUSACCO AD A G OCO Trp (W) \u« 9799%3Fo 33 4ule_2023_Spring_Stu x M Inbox (1) - Ic21-0506@lclari X =6104_EP#6 - Google Docs ent/d/104sNODGApfrUg768nDS9piPmOB-VzXs86b_t-tDcDF8/edit My Drive - Google... WebAdvisor Main... ols Extensions Zotero Help text T Arial Haplontic life cycle Diplontic life cycle Parthenogenesis Karyotype Histone - 11 + 2 4. Match the words with the correct definitions: | Alternation of generations Job Listing - USF... WT Enrollment Requir... B I U 3 4 X 0 Lecture Video: The Cell Cyc x Chemical Principl... UO UND Orn Z = - 1:3 A type of reproduction that produces a clone of the mother A protein DNA wraps around it to condense the DNA An organism alternates between 1n and 2n with each generation A complete set of chromosomes, as they appear in the nucleus When an organism spends most of its life in the 1n state When an organism spends most of its life in the 2n state 11Ugy Final Exam - Biology Final Exam - RELAX! - K1 x+ A learning.k12.com/d21/le/enhancedSequenceViewer/1433017?url=https%3A%2F%2Fe02711f5-1353-40b6-af9b-3497ff846bd.sequences.api.b Apps KI2 K12.com KI2 OLS Login O My Info K12 Customer Supp. Class Connect O LogMeln123 KI2 Microsoft Office 365 xfinity | Portal ( Back to Content Biology Final Exam Time Limit: 2:00:00 Time Left:1:25:28 Nizyree Dotson: Attempt 2 Question 9 (1 point) Which of these processes is not a type of reproduction? 7. 8 Sexual 10 11 12 Asexual 13 14 15 O Mitosis Metabolism 16 17 18 Question 10 (1 point) E A X C V B N M
- ty of Indianapolis : 20202 X ace.uindy.edu/portal/site/202020-BIOL-104-07/tool/2e4f1021-614d-4fae-83d6-ff99ca3767e0/jsf/delivery/beginTakingAssessment M Gmail YouTube Maps A ApneTV Home of H... What is the first step in protein synthesis? O A. making an RNA copy of the DNA within the nucleus B. making a sequence of amino acids O C. forming peptide bonds between amino acids OD. making a copy of RNA with DNA outside the nucleus Reset SelectionAutoSave O Off # 2 Mol Bio Mutation QUESTIONS - Saved to this Pc - O Search A MST MCHUNU MT File Home Insert Design Layout References Mailings Review View Help Chemistry 合 Share P Comments (i) SIGN IN TO OFFICE It looks like your stored credentials are out of date. Please sign in as 20******@ke****** za so we can verify your subscription. Sign In Complete the following tasks. You are fresh recruits to a molecular biology laboratory, and your new boss has tasked you to study mutations in NRAS, a gene that she suspects is involved in cancer pathogenesis. Task A: Polymerase Chain Reaction Master Mix Your first task is to isolate and amplify the NRAS gene from CDNA extracted from different samples through PCR. You will need to run a total of 7 PCRS: 3 normal samples, 3 cancerous samples, and 1 negative control. To make things easier in the lab, when running multiple reactions, the components are prepared not individually, but as a master mix-all the components for multiple reactions are…E Classwork for BTMF_Itani_ Biolo X E SI'ERRA STANLEY - protein-synth X arch 8 period light reaction - Google S x ocs.google.com/document/d/1plhyciPrM-AMsQKmaUHZSZU44EJL85jDuCyDxE01E60/edit LEY-protein-synthesis-worksheet_practice-converted ☺ Insert Format Tools Add-ons Help Last edit was 5 minutes ago 100% Normal text Noto Sans . BIUA 12 川, 三= + - I 1. 2 . 4. 5 PART C. Use your codon chart to determine the amino acid sequence. Remember to read through the strand and ONLY start on AUG and STOP when it tells you to stop. Follow example below: Example: DNA O AGA CGG TAC CTC CGG TGG GTG CTT GTC TGT ATC CTT CTC AGT ATC mRNA O UCU GCC AUG GAG GCC ACC CÁC GAA CAG ACA UAG GAA GAG UCA UAG protein 0 start - glu – ala -thre - hist – asp -glu-threo-stop acid acid 1. DNA → CCT CTT TAC ACA CGG AGG GTA CGC TAT TCT ATG ATT ACA CGG TTG CGA TCC ATA ATC MRNA → protein → 2. DNA → AGA ACA TAA TAC CTC TTA ACA CTC TAA AGA CCA GCA CTC CGA TGA ACT GGA GCA MRNA → protein → 围 Sign out Co & 6. 7
- A Classwork for BTMF_Itani_ Biolo x A S'ERRA STANLEY -protein-synth X O 8 period light reaction - Google S x google.com/document/d/1plhyciPrM-AMsQKmaUHZSZU44EJL85jDuCyDxE01E60/edit - protein-synthesis-worksheet_practice-converted O sert Format Tools Add-ons Help TUR Last edit was 10 minutes ago 0% Normal text Noto Sans BIUA 川。 三E▼=、三三 13 + 田回▼ 1 3 4. 5 8. DNA → TAC AGA CGG CAA CTC TGG GTG CTT TGT TCT CTT CTC AGT ATC mRNA → protein > Son out Co 4. 6. 8. 9.G-Unit 5: DNA anc X https://docs.goog x y google classroom x A Classes QLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHNOOdqFX_aDbV_6-bKw/formResponse of Distance Le... Launch Meeting - Z.. 4 2020 HORNETS 4N... StudentVUE Clear s How is a protein made in the cell? * One strand of DNA in the ribosome combines with amino acids. Two strands of DNA in the nucleus combine with amino acids. One strand of RNA in the ribosome is the template (model) for an amino acid sequence. Two strands of RNA in the nucleus are the template (model) for an amino acid sequence. Use the chart to determine the correct amino acid that this DNA would code for - ATA EGFL Y. UCAGUCAG Gutame Aspart ac8 period light reaction - Google 1plhyciPrM-AMsQKmaUHZSZU44EJL85jDuCyDxE01E60/edit LEY RA STANLEY-protein-synthesis-worksheet_practice-converted D O dit View Insert Format Tools Add-ons Help Last edit was 9 minutes ago 100% - Normal text Noto Sans . 12 BIUA 叫, 三三▼ = I 1 1 2 3. 5 . . 6 7 6. DNA → TAC CTT AGT TAT CCA TTG ACT CGA ATT GTG CGC TTG CTG ATC MRNA → protein > 7. DNA → ACC CGA TAC CTC TCT TAT AGC ATT ACA AAC CTC CGA GCG MRNA → protein → Sign out 7 8. 3 4. e
- 6. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…AutoSave O Off # 2 Mol Bio Mutation QUESTIONS - Saved to this Pc - O Search A MS T MCHUNU MT File Home Insert Design Layout References Mailings Review View Help Chemistry A Share P Comments (i SIGN IN TO OFFICE It looks like your stored credentials are out of date. Please sign in as 20*****@ke****** za so we can verify your subscription. Sign In Task B [5 points]: Sanger sequencing Having successfully amplified the NRAS gene from wild-type and cancerous tissue through PCR, you now sent your PCR product for sequencing. However, the only available technology to you is classical Sanger sequencing or the dideoxy chain termination method, explained in Figure 2. Shown below are the sequencing gels obtained for the sections of the wild-type and mutant NRAS genes where the mutation can be found. WILD-TYPE NRAS MUTANT NRAS ddA ddT ddC ddG ddA ddT ddC ddG 1. Determine the 5'-to-3' sequence of the wild-type TEMPLATE strand. Answer: 5' 3' 2. Using the codon table given below, determine the…Design alibri Y Layout 12.5 O I Uabe X₂ X² A-ay-A Font mRNA: Unique Unigriffin DNA: traits: ▼ wwww DNA: to search mRNA: References 13 A A Aa-A5-5-5- mRNA: amino acids: traits: DNA: # > amino acids: traits: How DNA Determines Traits- Transcription and Translation Fill in easier type.pptx part 2 - Word Mailings Review View ACROBAT Tell me what you want to do... A¶ | CAG TCG TTT | ATG GGG CTT CTT TIT | GAG AAT TCA CGC | wwwww | CGA CAA CAC | GTA GTA | CAA AAA ATG | TTA TAG AAT GAC GGG TGG | wwww 14 | TTA TTG TTA CGG | AAA AGA CCT | GCA GCC TTG TGT | O $ Paragraph =-12-18 15 % AaBbCcDc AaBbCcl AaBbCcL AaBbCcDc AaBb CcDc ¶ Normal T Body Text 1 List Para... 1 No Spac... 1 Table Par... Styles 16 W 18 7 C fg OM f10 num lk (p)) 捆 AaBbCc[ Aa Bb 1 Heading 1 1 Head 10000 00000 J 0 36°F