HO-P-O-ΟоNH2OH OHNOHO-P-O-P O-POΟΟOHNH2Which statement is true about the nucleic acid precursor molecules shown?a. The one on the left is a precursor for DNA. It is thymine triphosphate.b. The one on the left is a precursor for DNA. It is cytosine triphosphate.c. The one on the right is a precursor for DNA.d. Both are commonly incorporated into stable DNAe. Neither are precursors for DNA.

To determine the correct statement, we need to correctly identify the given molecules and their…

Answered: HO-P-O- Ο о NH2 OH OH N O HO-P-O-P O-P…

Human Heredity: Principles and Issues (MindTap Course List)

11th Edition

ISBN:9781305251052

Author:Michael Cummings

Publisher:Michael Cummings

Chapter8: The Structure, Replication, And Chromosomal Organization Of Dna

Section: Chapter Questions

Problem 12QP: DNA contains many hydrogen bonds. Are hydrogen bonds stronger or weaker than covalent bonds? What...

See similar textbooks

Similar questions

The alkaline hydrolysis of pAUGCAGC oligonucleotide produces: O A. Uridine 2'-monophosphate, uridine 3'-monophosphate, cytosine 2'-monophosphate O B. Adenosine 2'-monophosphate, adenosine 3'-monophosphate, adenosine 21,5'-bisphosphate OC. Guanosine 2'-monophosphate, guanosine 3'-monophosphate, cytosine 3'-monophosphate O D. Cytidine 3'-monophosphate, guanosine 2'-monophosphate, adenine 2'-monophosphate O E. Adenine 3,5'-bisphosphate, guanine 2,5'-bisphosphate, uridine 2'-monophosphate O F. Uridine 2'-monophosphate, uridine 3'-monophosphate, guanine 3'-monophosphate
(a) Draw the structure of the high-energy nucleoside triphosphate GTP. (b) Draw the structure of the hydrolysis product formed when one phosphate is removed.
The non-sense mutations may be suppressed by_ Select one: O a. a mutated tmRNA O b. a mutated glycosylase O c. a mutated TRNA O d. a mutated tRNA
DNA contains thymine rather than uracil. Why is the presence of thymine in DNA advantageous? What effect would the presence of uracil in DNA have on DNA repair?
a) Identify three types of RNA and provide a description of each and the role they play in protein synthesis. (6 marks) b) Use the DNA sequence below to answer the following questions. 3' - TACGAACGAGTGCCCCAAAATT -5' What is the complementary DNA strand? (1 mark) What is the nucleotide sequence of the mRNA strand transcribed from the initial DNA strand? (1 mark) Provide an alternative mRNA sequence with four changes that would translate to the same amino acid sequence. (2 marks) Paragraph I A + v ... Lato (Recom... v 19px ... v Add a File Record Audio Record Video MacBook Pro G Search or type URL #3 2$ & ( 3 4 7 8 9 山訓 < CO
Umoles SH 2. ASE-3: A polypeptide that has the smell of a rotten egg was extracted from plant. You being a good MD with excellent knowledge of biochemistry performed the following: Titrated the polypeptide with DTNB. The absorbance of the obtained yellow color was 0.16. I. 1. Compared to a standard curve of-SH (Curve A below ), the estimated free -SH is A. Not possible to determine unless the polypeptide amino acid composition is known B. 1 umole of Cys C. 1 umole of either methionine or cysteine 2. Treatment of the polypeptide with DTT followed by DTNB yielded an absorbance of 0.81, indicating that the polypeptide: A. Contains 5 disulfide bridges B. Contains 5 Cys C. Was inaccurately titrated in the above situation yielding lumole D. Contains 3 intra-molecular disulfide bridges. 5. 4. 1. 0.2 0.4 0.8 1. Abs orbance 3. The polypeptide is composed of deca and nona peptides with: N- terminals of ala and val respectively and C-terminals of asn and lys respectively. The Decapeptide is…
b. What is the difference between the 3' and the 5' ends of a nucleotide chain? C. Do the chains run the same way? d. How are the chains connected? e. Which bases bond to each other? f. What kinds of bonds hold the chain together? 3. What are the main differences between RNA and DNA? 4. Distinguish between the structure of pyrimidines and purines. Explain why adenine bonds only to thymine. 5. Name the five nitrogenous bases in the table below, and put an X in the correct column for each base. Then indicate if the base if found in DNA (D), RNA (R), or both (B) hp
Considering the principle of complementary base pairing, you would expect an equal ratio of which two nitrogenous bases in a DNA molecule? a. guanine and thymine b. uracil and adenine c. thymine and cytosine d. cytosine and guanine e. adenine and guanine
Bovine insulin is composed of two polypeptide chains that are linked together covalently. The two chains have the following sequences: GIVEQCCASVCSLYQLENYCN - A chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA - B chain a. Through which amino acids are these two chains linked together covalently? b. How many different ways can these two chains be linked? c. Of the different connectivities you enumerated in part b, which is the biologically active form?
Given the following DNA strand: TACAGAGATAACCGAATT A. Write the corresponding strand that would form the other half of the DNA molecule. B. Transcribe the original DNA strand (TACAGAGATAACCGAATT) and write the sequence of bases found in the resulting messenger RNA molecule. C. Translate your messenger RNA molecule and write the sequence of amino acids in the resulting protein (the genetic code is provided below).
Match the following nucleobases (designated AD) with their names and answer questions about them. NH, NH, C D NH2 Note that some of the items from the answer list should NOT be used. Guanine 1. Aand B - Cytosine 2 Cand D • Adenine 3. Not shuwn v Thymine 4. D v Uracil 5. B a Aand C v Which of tho shown bases are pyrimidines? 7. A and O v Which of the shown bases form canonical A-T Watson-Crick base pair? S. A v Which of the shown bases form canonical G-C Watson.Crick base-pair? 9. Band C 10. C 11. Band D
Cystic Fibrosis is caused by which of the following? a. Replacement of three nucleotides with a new three nucleotide sequence b. Addition of three nucleotides c. Deletion of three nucleotides

SEE MORE QUESTIONS

Recommended textbooks for you

Human Heredity: Principles and Issues (MindTap Co…

Biology

ISBN:

9781305251052

Author:

Michael Cummings

Publisher:

Cengage Learning

Concepts of Biology

Biology

ISBN:

9781938168116

Author:

Samantha Fowler, Rebecca Roush, James Wise

Publisher:

OpenStax College

Human Heredity: Principles and Issues (MindTap Co…

Biology

ISBN:

9781305251052

Author:

Michael Cummings

Publisher:

Cengage Learning

Concepts of Biology

Biology

ISBN:

9781938168116

Author:

Samantha Fowler, Rebecca Roush, James Wise

Publisher:

OpenStax College

SEE MORE TEXTBOOKS