Complete the sentence to make it true. The single most important contribution to the stability of a water soluble globular protein's conformation appears to be the sum of free energies of formation of many weak interactions among the hundreds of amino acids in a protein. entropy increase from the decrease in the number of ordered water molecules forming a solvent shell around the unfolded protein. sum of free energies of formation of many weak interactions between a protein's polar amino acids and surrounding water. maximum enthalpy increase from ionic interactions between the ionized amino acids in a protein. stabilizing effect of hydrogen bonding in a protein between the carbonyl group of one peptide bond and the amino group of another

Complete the sentence to make it true. The single most important contribution to the stability of a water soluble globular protein's conformation appears to be the sum of free energies of formation of many weak interactions among the hundreds of amino acids in a protein. entropy increase from the decrease in the number of ordered water molecules forming a solvent shell around the unfolded protein. sum of free energies of formation of many weak interactions between a protein's polar amino acids and surrounding water. maximum enthalpy increase from ionic interactions between the ionized amino acids in a protein. stabilizing effect of hydrogen bonding in a protein between the carbonyl group of one peptide bond and the amino group of another

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Similar questions

Explain why trimethylamine, (CH3)3N, has a considerably lower boiling point thanpropylamine CH3CH2CH2NH2, even though both compounds have the same molecularformula. Use drawings to fully explain your answer.
The protein collagen has an isoelectric point of pl = 6.60. This is the pH at which the number of positive charges on the protein surface equals the number of negative charges on the protein surface. At which of the following solution pH values will collagen be in solution and at which will it tend to aggregate? pH = 12.89 pH = 4.07 PH = 6.50 Clear All The protein will be in solution. The protein will tend to aggregate.
classify the molecules of interest (i.e. para-aminophenol, acetaminophen, phenacetin) in increasing order of polarity? Rationalize these observations based on molecular interactions.
A peptide has the sequence Glu–His–Trp–Ser–Gly–Leu–Arg–Pro–Gly The p?a values for the peptide’s side chains, terminal amino groups, and carboxyl groups are provided in the table. Amino acid Amino pKa Carboxyl pKa Side‑chain pKa glutamate 9.609.60 2.342.34 4.254.25 histidine 9.179.17 1.821.82 6.006.00 tryptophan 9.399.39 2.382.38 serine 9.159.15 2.212.21 glycine 9.609.60 2.342.34 leucine 9.609.60 2.362.36 arginine 9.049.04 2.172.17 12.4812.48 proline 10.9610.96 1.991.99 Calculate the net charge of the molecule at pH 11 and estimate the isoelectric point (pI)(pI) for this peptide.
Please help answer these questions on natural polymers
Chemistry Write structure for oligopeptides “Boc-CPID-benzyl ester” and “Methy ester-CGLK-Boc”. Also show all the possible types of bonding between the two peptide chains.
Q6-1 Formation of DNA is pairing up RNA. In solution containing two RNA moving independently. When DNA forms, two RNA fuse. DNA seems more ordered than two independent RNA Yet, formation of DNA is spontentanious. Explain why that is the case Q6-2 Is it possible to make AG, H,O(s) = AG, H,O(g). if it is possible, give an example. Otherwise, explain why this can not happen.
The composition in mole fraction units of the strands of a double-helical DNA is [A]= 0.30 and [G] = 0.24. A) What can you say about [T] and [C] for the same strand? B) What can you say about [A], [G], [T] and [C] of the complementary strand?
Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1
All amino acids have two ionizable functional groups: an a-amino group (average pK, of 9.4) and an a-carboxylic acid group (average pK, of 2.2). Glutamic acid has an ionizable side chain (R group) with a pK, of about 4.1. One of the possible ionization states of glutamic acid is shown in the image. H₂N-CH-C-OH CH₂ At what pH would this structure of glutamic acid be the predominant ionization state? Consider the ionization state of all three of the functional groups. OH The protonated form of the R group of glutamic acid is shown in the structure. The ratio of the protonated form to the charged (deprotonated) form depends on the pK, of the R group and the pH of the solution. 2.6 4.1 1.5 Select the pH values at which the charged form of the R group would predominate. 7.0 11.3
Secondary structure is: the sequence of the amino acids on the peptide-bonded chain. dependent on the interaction of multiple polypeptide chains to make up the functional protein. the arrangements of amino acid side groups within a protein. based on the arrangement in space of the atoms in the peptide backbone. the three-dimensional arrangement of all the atoms in the protein.
Explain the importance of the dielectric constant of water in stabilazing hydrophobic interaction amoung biomolecule