(a) 2,3-Bisphosphoglycerate (BPG) reduces binding of O₂ to hemoglobin from almost hyperbolic to sigmoidal shape by stabilizing the T state. (b) CO2 is an end product of cellular respiration that is transported by Hb from tissue to lungs in the form of a carbamate moiety. (c) Four molecules of BPG bind to one molecule of hemoglobin. (d) Both H+ and CO₂ bind in a manner inversely related to the binding of O₂ (e) CO2 binds as a carbamate group to the a amino group at the amino terminal end of each Hb chain.
Q: Why is it important to know the length of the dna sequence you digest?
A: In molecular biology, A target DNA molecule is digested by using restriction enzymes, and the…
Q: Use the gel image below to determine the sequence of the original DNA template strand sequenced…
A: As per the Watson-Crick model of the DNA double helix: DNA is made up of two strands of…
Q: 1 ).Which of the following accurately describes substrate specificity for serine proteases? A.The…
A: Amino acids are biomolecules that have an amino group, a carboxyl group and a side group attached to…
Q: I now know the structure difference between myoglobin and hemoglobin , however which exctaly…
A: Myoglobin is a monomeric globular protein of 154 amino acids residues with an oxygen binding site.…
Q: One of your colleagues has obtained a sample of muscle phosphorylase b that is known to be…
A: Glycogen is storage-type homopolysaccharides that contain two types of glucose polymers: amylose:…
Q: When glycogen is degraded (catabolized), all of the following occur in both liver and muscle EXCEPT…
A: Glycogenolysis is the process of breaking down the stored glycogen into simple sugar units. It…
Q: In the experimental set up to show that "CO, is given out during respiration", name the substance…
A: Respiration is a metabolic process that all organisms go through. It is a biochemical process that…
Q: The structure of purine is shown. 2 N-1 N-3 N-7 N-9 6 5 N 4 3 7 N -N9 ZI 8 Which atoms of the purine…
A: Purines: The two groups of nitrogenous bases, which also include the two groups of nucleotide…
Q: b-oxidation occurs ONLY under aerobic conditions. Why? Glycolysis occurs under anaerobic conditions,…
A: Beta-oxidation of fatty acids is the process by which long chain fatty acid molecules are broken…
Q: A pentapeptide has the abbreviation "GREAT". Draw the peptide and give its systematic name.
A: Peptides are short sequences of amino acids. Amino acids in a peptide are joined together through…
Q: Question 9 Briefly discuss the discovery and development of selective inhibitors of sodium-glucose…
A: Sodium-glucose linked transporters (SGLTs) , or to be more specific Sodium-glucose linked…
Q: Identify the enzyme. catalyzes REDOX reactions catalyzes structural rearrangement of molecules…
A: Enzymes are biocatalysts which increase the rate of biochemical reactions. Enzymes are classified…
Q: Which functional groups are present in digitoxin? a. To what lipid family does the complex ring…
A: Lipids are a chemically diverse group that have two things in common: low solubility in water and…
Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: You are running an ELISA to test three patients for COVID-19.The results of the test are shown below…
A: ELISA (enzyme-linked immunosorbent assay) is a enzyme linked analytical assay in which presence of a…
Q: One of the molecules listed below is effective in reducing O2 affinity of human Hb in the absence of…
A: Hemoglobin is a globular protein, ie it is roughly spherical. It is a tetramer of two types of…
Q: Fill out the last column of this table: Component 1X concentration 20X (Provide unit)
A: The dilution factor tells us how much of the original stock solution is present in the final…
Q: 4. In the space below provide a mechanism for this reaction that proceeds through the intermediate…
A: Glycolysis is the process by which one molecule of 6-carbon glucose is broken down into 2 molecules…
Q: Provide the name of the following nitrogen-containing heterocyclic base. Z-I N A NH TU
A: The four major classes of biological macromolecules are nucleic acids, proteins, lipids and…
Q: Describe experimental enzyme inhibition and how it leads to a deeper understanding of enzyme…
A: Enzyme inhibition: The activation energy required for a reaction to occur is decreased by enzymes,…
Q: The patient has mechanical jaundice. Will it affect the absorption of fat-soluble vitamins? There…
A: To live a healthy and active life, humans need a variety of nutrients. Good nutrition, or the…
Q: What would be the effect of a visualizing agent on the retention factor. Rf? A.Higher Rf B.Lower RF…
A: Visualising agent: The chemical agents that can be used to detect the number and location of the…
Q: An enzyme has a single active site at which it can bind and hydrolyze either X or Y; however, the…
A: Enzymes are high molecular-weight proteins that catalyse biochemical reactions. They contain an…
Q: Which of the following statements is correct regarding the structures below? CHO CHO но-н H H-OH ОН…
A: Carbohydrates can be classified into different types depending on their size into the following…
Q: What are ketone bodies? How are they formed? What makes carboxylic acids acidic? Define the…
A: ketone bodies act as a source of energy under glucose and fat-deprived conditions. They are secreted…
Q: true/ false: When proteins are denatured 1°, 2°, 3°, and 4° structure is lost.
A: Denaturation is a process in which proteins lose their original structure or confirmation. The loss…
Q: Hormones and other signaling molecules: definition. Classification of hormones by chemical…
A: Hormones are chemical substance that are produced by endocrine glands. While paracrine signaling…
Q: name the reaction of the carbohydrate catabolism
A: The catabolism of carbohydrates is a series of redox reactions that produce energy from…
Q: How many ATP will be yielded in 2 moles of an 17:0 and 18:0 carbon chain?
A: Beta oxidation is a process of oxidation of fatty acids into acetyl CoA. The total amount of ATP…
Q: Which major biosynthetic pathways utilize PRPP? de novo purine synthesis lysine biosynthesis…
A: INTRODUCTION: De novo purine synthesis- it is the synthesis of complex molecules from simple…
Q: A technician checks the column bed volume on a column that is supposed to be 2ml. If the bed volume…
A: Column chromatography is a separation and purification technique. Column chromatography requires a…
Q: The purpose of the progress curve is to determine if an enzymatic reaction rate remains constant for…
A: The progress curve is the measure of enzymatic velocity in a reaction. Velocity is given by the rate…
Q: Which of these is NOT true of nucleosomes? A. Some post-translational modifications to histone…
A: Nucleosome is the basic subunit of chromatin. It is the basic unit of DNA packaging. Nucleosomes…
Q: Uncouplers of oxidative phosphorylation are all expect: Select one: O a. thermogenin O b.…
A: INTRODUCTION: (Oxidative phosphorylation) The process by which ATP is formed as a result of the…
Q: Name four amino acids that can be synthesized using pyruvate as a starting material. What one(s) of…
A: Amino acids are biomolecules that have an amino group and a carboxyl group linked to the same carbon…
Q: What percentage of molecules of peptide GGGG has no ionized groups (e.g. has BOTH protonated…
A: Amino acids: An amino acid can function as both an acid and a base because of its structural…
Q: An unknown sample was tested if there is a presence of lipid, after the test it shows that it is…
A: These are the various preliminary and qualitative tests to estimate the presence and nature of…
Q: 1. What role do eicosanoids play in the body? What is the primary fatty acid in their composition?…
A: INTRODUCTION : Eicosanoids - They are classified as a group of molecules which are being derived…
Q: What test tube will show positive starch hydrolysis and negative starch hydrolysis?
A: Starch is the most common carbohydrates (polysaccharides) which is a polymer of several glucose…
Q: What is the role of HCO3 in the activity of pancreatic enzymes? 2. What factors are needed in the…
A: DISCLAIMER FOR MULTIPART Since you have posted a question with multiple sub-parts, we will solve…
Q: Please describe four different modes of the regulation of the pentose phosphate pathway.
A: Introduction:- The Question is all about the pathway of pentose phosphate cycle that synthesis via…
Q: Draw the electron pushing mechanism
A: It is the three-dimensional representation of chiral centres on paper. Horizontal lines represent…
Q: Draw the structure of alanylserine, a dipeptide made from alanine and serine, as it would appear at…
A: A dipeptide has two amino acid residues. Amino acid sequences are written with N-terminal amino…
Q: Which of the following results are most likely to be observed in liver enzymes following initiation…
A: When subjected to a prolonged period of starvation, the level of glucose in the blood falls. This…
Q: a) Determine kcat (in units of sec-1) for a particular enzyme, given the following information: Vo =…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: You have received a laboratory report showing the presence of a HIGH concentration of ketone bodies…
A: Our bodies use a variety of biomolecules as respiratory fuels. The oxidation of these respiratory…
Q: ATP is a source of free energy that drives unfavorable reactions. Which of the processes are coupled…
A: The free energy changes in chemical reactions are denoted by ΔG. ∆G = ∆H − T∆S where ∆H is the…
Q: Elongation of fatty acids chains beyond 16 carbons takes place: on the membrane of the endoplasmic…
A: Acetyl CoA from glucose oxidation or other anaplerotic reactions is produced in mitochondria and…
Q: Two (2) moles of GALACTOSE are completely oxidized to CO₂ and water using the malate-aspartate…
A: Glycolysis involves a series of reactions that convert glucose into pyruvate with the production of…
Q: Question 6 In membranes, one of the most common targets of reactive oxygen species are saturated…
A: Fatty acids are carboxylic acids with a hydrocarbon chain. Saturated fatty acids are fatty acids…
Step by step
Solved in 2 steps
- The 2-3 phosphoglycerate (BFG) binds to the central gap formed by the hemoglobin monomers (a2b2) facilitating the reversible release of oxygen. Approximate relationships between BFG concentrations in red blood cells and Pos in hemoglobin are in the table.a) Draw the reaction schemeb) Write the forces that condition the union between hemoglobin and BFG1.1 ;) The diagram on the right compares the O2 binding prop- 1.0 erties or normal adult hemoglobin (HbA) to those of one dubbed Hb Great-Lakes characterized by the mutation Leu(B68)His. In the dia- gram Y = fraction of heme groups with bound O2, and pO2, the par- tial pressure of O2 above the solution, is measured in units of torr or mmHg. Hb Great Lakes %3D 0.8 Hb A 0.6 Draw the corresponding Hill plot, being careful to reproduce graph- ically the dissociation equilibrium constant for O2 binding (Ko2) for Y each hemoglobin and to show the difference in the extent of allo- stery or cooperativity of subunit interaction in each type of hemo- globin. 0.4 You need draw only the central, linear portion of the Hill plot. 0.2 F State what is the likely magnitude of the Hill constant (nH) for HbA from your reading and state what is the likely range of the magni- tude of the Hill coefficient for Hb Great Lakes. 0 10 20 30 40 50 60 pO2 (torr)A crocodile, which can remain underwater without breathing for up to 1 hour drowns its air-breathing prey, then dines at its leisure. An adaptation that aids the crocodile in doing so is that it can utilize virtually 100% of the O2 in its blood whereas humans, for example, can only extract about 65% of the O2 in their blood. Crocodile Hb does not bind BPG. However, crocodile deoxyHb preferentially binds HCO3-. How does this help the crocodile obtain its dinner? Please help explain why/if this is the answer, thank you! As CO2 concentrations increase so will the concentration of HCO3-. The HCO3- preferentially binds to the crocodile's deoxyhemoglobin, which allosterically prompts the hemoglobin to assume the deoxy conformation and thus release its O2.
- Given the oxygen dissociation curves, which of the following statements are correct? Which residue in HbA β do you think contributes the most to the increased interaction between HbA aand 2,3‑BPG?What qualitative effect would you expect each of the following to have onthe P50 of hemoglobin?(a) Increase in pH from 7.2 to 7.4(b) Increase in PCO2 from 20 to 40 mm Hg(c) Dissociation into monomer polypeptide chains(d) Decrease in 2,3-BPG concentration from 7 mM to 5 mM in red cells.Determin the respiratory exchange ratio of C18H36O2(s) + 26O2(g) → 18CO2(g) + 18H2O(l)
- 2.(a) The two diagrams on the right compare O2 binding pro- perties of Hb Kariya, a human hemo- globin characterized by the mutation Lys(a40)Glu, with those of HbA as a function of pH ranging from pH 9.0 to pH 6.95. One O2 saturation curve () illustrates the O2 binding proper- ties at pH 7.5 in the presence of 2 mM inositol hexaphosphate (IHP). (IHP is found in avian red blood cells. and binds more tightly than BPG be- cause of the additional negative charges.) log [Y/(1 - Y)] Hb Kariya + IHP (b) The diagram on the right illustrates sche- matically the interaction of the side chain of the aLys40 residue with the C-terminal -COOH group of the B-sub- unit in HbA. In Hb Kariya with a Lys(a40)Glu mutation, which allosteric conformation R or T is destabilized, and which allosteric HbA conformation is illustrated on the right? Explain log (P) Excluding the O2 saturation curve collected in the presence of inositol-hexaphosphate (IHP), indicate with an arrow for both hemoglobins the plot…In nature, there are some organisms that are unable to perform aerobic respiration in the presence of oxygen. What could be the possible reason(s) behind this phenomenon? (Answe in 120 words, 5 reasons would be helpful) Thanks3. (a) The (acid) Bohr effect is defined as the up- take of protons by hemoglobin molecules at pH ≤ 6.5 as O2 is dissociated from the protein in solution. Approxi- mately 0.6 mole protons are taken up for each mole of O2 released by normal human hemoglobin. The effect is seen as a "shift to the right" in the O2 dissociation curves with decrease in pH, indicating that the O2 binding affinity of Hb decreases at lower pH. On the right is a diagram compar- ing the pH dependence of the p50 values of Hb Deer Lodge [His(32)Arg] (filled symbols) and of HbA (- - -) in the absence of organic phosphates, i.e., “Stripped”, and in the presence of saturating concentrations of IHP. On the basis of the definition of the Bohr effect given above, explain why the data in the diagram reflect the Bohr effect for the two types of human hemoglobins. log p50 1.5 1.0 0.5 0.0 -0.5 5 6 stripped 7 pH +DPG 8 IHP 9 (b) The Bohr effect is generally decreased in Hb Deer Louge compared to that in HbA. Provide an…
- One of the molecules listed below is effective in reducing O2 affinity of human Hb in the absence of BPG: (1) Glucose 6-phosphate (2) Inositol hexaphosphate (3) Maleic acid (4) Lactate (5) Arginine - Interestingly, this molecule plays the role of BPG in bird and turtle hemoglobin. A) Write the chemical structure of each molecule mentioned above. (B) Predict what molecule is most effective in preventing O2 binding to Hb. In 20 words or less explain the rationale for your predictionStudies of oxygen transport in pregnant mammals have shown that the O2-saturation curves of fetal and maternal blood are markedly different when measured under the same conditions. Fetal erythrocytes contain a structural variant of hemoglobin, HbF, consisting of two γ and two β subunits (γ2β2), whereas maternal erythrocytes contain HbA (α2β2). (a) Which hemoglobin has a higher affinity for oxygen under physiological conditions, HbA or HbF? Explain. (b) What is the physiological significance of the different O2 affinities? (c) When all the BPG is carefully removed from samples of HbA and HbF, the measured O2-saturation curves (and consequently the O2 affinities) are displaced to the left. However, HbA now has a greater affinity for oxygen than does HbF. When BPG is reintroduced, the O2-saturation curves return to normal, as shown in the graph. What is the effect of BPG on the O2 affinity of hemoglobin? How can the above information be used to explain the different O2 affinities of…Studies of oxygen transport in pregnant mammals show that the O2-saturation curves of fetal and maternal blood are markedly different when measured under the same conditions. Fetal erythrocytes contain astructural variant of hemoglobin, HbF, consisting of two α and two γ subunits (α2 γ2 ), whereas maternal erythrocytes contain HbA (α2β2).(a) Which hemoglobin has a higher affinity for oxygen under physiological conditions, HbA or HbF? Explain.(b) What is the physiological significance of the different O2 affinities?(c) When all the BPG is carefully removed from samples of HbA and HbF, the measured O2 -saturation curves (and consequently the O2 affinities) are displaced to the left. However, HbA now has a greater affinity for oxygen than does HbF. When BPG is reintroduced, the O2 -saturation curves return to normal, as shown in the graph. What is the effect of BPG on the O2 affinity of hemoglobin? How can the above information be used to explain the different O2 affinities of fetal and…