Homework Help is Here – Start Your Trial Now!
Science
Biology
5) Interpreting Data: For the following question, consider the table and graph presented below. p24 pg/ml B10? A V3 amino acid sequence molecular clone 296 306 317 320 324 charge* SI phenotype** 10 168.1 CTRPNNNTRKSIHIGPGRAFYATGDIIGDIRQAHC 3+ 168.10 6+ Mutagenesis set 10° X. 168.1/RT 4+ * *** ...- 168.1/RQ --Q-- 10 5+ 168.1/RN -R- -N------ 5+ 168.1/RTQ 5+ 103 + .--- 168.1/RTN T---N------ 5+ + 168.1/RON -0---N------ 6+ 102 10 2 4 6 10 12 14 days after transfection Table SEQ Table * ARABIC 3 and Graph 2 All the lines on the graph represent the effect of one molecular clone. What molecular clone does line X lescribe? How did come to such a conclusion? Answer: Line X is Molecular clone is the negative control group. We came to this conclusion because the egative control groun is the only one with 3+ charợe and a negative SI phenotype

5) Interpreting Data: For the following question, consider the table and graph presented below. p24 pg/ml B10? A V3 amino acid sequence molecular clone 296 306 317 320 324 charge* SI phenotype** 10 168.1 CTRPNNNTRKSIHIGPGRAFYATGDIIGDIRQAHC 3+ 168.10 6+ Mutagenesis set 10° X. 168.1/RT 4+ * *** ...- 168.1/RQ --Q-- 10 5+ 168.1/RN -R- -N------ 5+ 168.1/RTQ 5+ 103 + .--- 168.1/RTN T---N------ 5+ + 168.1/RON -0---N------ 6+ 102 10 2 4 6 10 12 14 days after transfection Table SEQ Table * ARABIC 3 and Graph 2 All the lines on the graph represent the effect of one molecular clone. What molecular clone does line X lescribe? How did come to such a conclusion? Answer: Line X is Molecular clone is the negative control group. We came to this conclusion because the egative control groun is the only one with 3+ charợe and a negative SI phenotype

Human Anatomy & Physiology (11th Edition)
Human Anatomy & Physiology (11th Edition)
11th Edition
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:Elaine N. Marieb, Katja N. Hoehn
Chapter1: The Human Body: An Orientation
Section: Chapter Questions
Problem 1RQ: The correct sequence of levels forming the structural hierarchy is A. (a) organ, organ system,...
See similar textbooks
icon
Related questions
Question

please asap

5) Interpreting Data: For the following question, consider the table and graph presented below. A V3 amino acid sequence B10? 7 p24 pg/ml molecular clone 296 306 317 320 324 只日 charge* SI phenotype** 168.1 CTRPNNNTRKSIHIGPGRAFYATGDIIGDIRQAHC 3+ 168.10 ---T--Q---N- 6+ Mutagenesis set 5 10 168.1/RT --T---- 4+ *** 168.1/RQ -R- 5+ 104 168.1/RN -N- 5+ + 168.1/RTQ -T--Q- -T-- 5+ + 168.1/RTN 168.1/RQN -R 103 ---- 5+ -R- -Q---N------ 6+ 102 101 4 6 8 10 12 14 days after transfection Table SEQ Table \* ARABIC 3 and Graph 2 All the lines on the graph represent the effect of one molecular clone. What molecular clone does line X describe? How did come to such a conclusion? Answer: Line X is Molecular clone is the negative control group. We came to this conclusion because the negative control group is the only one with 3+ charge and a negative SI phenotype.
Transcribed Image Text:5) Interpreting Data: For the following question, consider the table and graph presented below. A V3 amino acid sequence B10? 7 p24 pg/ml molecular clone 296 306 317 320 324 只日 charge* SI phenotype** 168.1 CTRPNNNTRKSIHIGPGRAFYATGDIIGDIRQAHC 3+ 168.10 ---T--Q---N- 6+ Mutagenesis set 5 10 168.1/RT --T---- 4+ *** 168.1/RQ -R- 5+ 104 168.1/RN -N- 5+ + 168.1/RTQ -T--Q- -T-- 5+ + 168.1/RTN 168.1/RQN -R 103 ---- 5+ -R- -Q---N------ 6+ 102 101 4 6 8 10 12 14 days after transfection Table SEQ Table \* ARABIC 3 and Graph 2 All the lines on the graph represent the effect of one molecular clone. What molecular clone does line X describe? How did come to such a conclusion? Answer: Line X is Molecular clone is the negative control group. We came to this conclusion because the negative control group is the only one with 3+ charge and a negative SI phenotype.
Expert Solution
trending now

Trending now

This is a popular solution!

steps

Step by step

Solved in 2 steps

SEE SOLUTIONCheck out a sample Q&A here
Blurred answer
Knowledge Booster
Environmental health & hazards
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.
Recommended textbooks for you
Human Anatomy & Physiology (11th Edition)
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:
9780134580999
Author:
Elaine N. Marieb, Katja N. Hoehn
Publisher:
PEARSON
Biology 2e
Biology 2e
Biology
ISBN:
9781947172517
Author:
Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:
OpenStax
Anatomy & Physiology
Anatomy & Physiology
Biology
ISBN:
9781259398629
Author:
McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:
Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:
9780815344322
Author:
Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:
W. W. Norton & Company
Laboratory Manual For Human Anatomy & Physiology
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:
9781260159363
Author:
Martin, Terry R., Prentice-craver, Cynthia
Publisher:
McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)
Inquiry Into Life (16th Edition)
Biology
ISBN:
9781260231700
Author:
Sylvia S. Mader, Michael Windelspecht
Publisher:
McGraw Hill Education
SEE MORE TEXTBOOKS