Please give answer all questions with explanation Chemistry3. A sample of toluene in injected on a capillary column with an ID of 250 microns and a nonpolarstationary phase. The toluene elutes with a retention time of 358 second. An unretained referencematerial injected on the same column has a retention time tm of 38 seconds. The partitioncoefficient K for toluene with this stationary phase is 337. Calculate the film thickness of thestationary phase in the column.4. On a GC column with L= 30 m, a reference sample elutes in 13.1 min with w1/2 = 15 sec. What is thenumber of theoretical plates? What is the plate height?

“Since there are multiple questions and it is not mentioned that which one has to be solved so I…

Answered: 4. On a GC column with L= 30 m, a…

4. On a GC column with L= 30 m, a reference sample elutes in 13.1 min with w1/2 = 15 sec. What is the number of theoretical plates? What is the plate height?

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Related questions

Q: Molecules that are nonsuperimposable mirror images of one another are called

A: They are optically active isomers .These molecules have same molecular mass but rotate the plane…

Q: To be a nucleotide OR protein it MUST have a nitrogenous group. This answer is wrong.

A: Ketone group found in the system.

Q: What is different about the primary structures of RNA and DNA? Match the words in the left column to…

A: DNA and RNA are types of nucleic acid .DNA stands for deoxyribonucleic acid and RNA stands for…

Q: The amides in the peptide backbone determine the [Select ] structure of a protein and the side…

A: The pattern in which amino acids are linked is called protein's primary structure.

Q: The side chain of cysteine is weakly acidic. Suppose in a protein, the side chain of a cysteine…

Q: The use of salt bridges or hydrophobic interactions (or pockets) to stabilize interactions between…

A: The quaternary structure of a protein is the association of several protein chains or sub-units into…

Q: Consider the amino acid glycine. Note: Reference the Naturally-occurring amino acids table for…

A: Amino acids are building precursors of various proteins. There are 20 naturally occurring amino…

Q: Protease enzymes are a type of protein made up of: Select one: Peptide Carbohydrates Pepsin Amino…

A: Proteins that function as biological catalysts are known as enzymes. Catalysts help to speed up…

Q: Answer the following questions on the basis of the free energies of formation at 25°C shown in the…

A: (a) The mentioned peptide bond formation reaction can be represented as:…

Q: This image represents the structure of a protein segment with amino acid side chains pointing off…

A: Step 1 Amino acids are the building bits of large biomolecules named as proteins. In the structure…

Q: None

A: When a His side chain needs to form an ionic interaction with a chloride ion for protein X to be…

Q: To the following statement, answer true or false and explain your answer. Q)All chiral molecules are…

Q: Could you help me with these questions, please? My teacher will not help me. Thanks so much!! 1)…

A: Carbohydrates are the component of food. They are also called sugars. Aldohexoses are the…

Q: Outline the four general stages in an enzyme-catalyzedreaction.

A: Catalysts are those compounds which alters the rate of the reaction, may or may not interact during…

Q: X: reproduce the interatomic interactions Y: define a computable energy (such as Gibb's free energy)…

A: The complete structure of a protein can be divided into 4 based on the complexity: primary,…

Q: QUESTION 19 Briefly explain why there are + and - charges in the amino acid structures in the table…

Q: A chemist wanted to test his hypothesis that the disulfide bridges that form in many proteins do so…

A: The native enzyme has four disulfide linkages. So the denatured enzyme should have eight cysteine…

Q: what is isoelectric ph and calculate for glutamic acid?

A: A point where molecule carried no net charge called isoelectric point.

Q: Net charge and isoelectric point of an amino acid with an ionizable side group.Consider the net…

A: Hey since you have posted a question with multiple sub-parts, we will solve first three sub-parts…

Q: What two amino acids are in this picture? methionine and what else

A: Given, Based on the given structure of amino acid, the name of the amino acid is:

Q: riefly explain how you will separate amino acids mixture using the charge difference between the…

Q: If D-Glucose and D-Galactose were together in a mixture, can they be separated via physical means?…

A: Here we have to separate a mixture containing D-glucose and D- galactose by physical method.

Q: In x-ray studies of crystalline peptides, Linus Pauling and Robert Corey found that the C-N bond in…

A: #1: Given the bond length of the C-N bond in a peptide bonding is intermediate between C-N single…

Q: CH₂ H₂N ΝΗ CH2 CH₂ CH₂ CH₂ NH₂

A: A peptide bond is formed between two amino acid when these are incorporated to form polypeptide.

Q: Identifying specific interactions between residues in a protein Imagine the main chain of a protein…

A: Based on the image you've provided, here's how you can answer the questions about specific…

Q: If the pH of the solution is equal to isoelectric point of protein, the net charge of the protein is…

A: Asking is the net charge of protein at the iso electric point?

Q: ogen pept is rigid, take place about the N-Co and the Co-C bonds in a protein (Co is the a carbon…

Q: 1. It is observed that as temperature is increased, most protein molecules go from their defined,…

A: Each protiens have an optimum temparature for exixtence and activity. A noticeble decrease or…

Q: The peptide bond has partial double bond character, and therefore the atoms in the peptide bond can…

A: Peptides are made up of amino acids.The bond that connects two amino acids is known as peptide bond.

Q: H

A: Given

Q: Draw the structure of a diglyceride made from of 2 equivalents of myristic acid and identify any…

A: Didiglyceride is a glyceride made from two fatty acid chains that are covalently bound to a single…

Q: НОНН С. H,N-C-C-N-C-C-OH НОСН CH;CHCH, HOH H O TITT I H,N-C-C-N-C-C-OH d. H.NCH.CH.CH.СHН H

A: Amino acids are building blocks of proteins. they're concerned with many chemical and biological…

Q: Question attached

A: Monosaccharides are carbohydrates. It cannot be hydrolyzed into simpler compounds. The general…

Q: Draw the peptideTyr-Gly-Gly-Phe-MetClassify the peptideDipeptide, Tripeptide, Polypeptide or…

A: Peptides are the chains of amino acids linked together by peptide bonds. The basic functional group…

Q: Explain how an enzyme is able to catalyze the synthesis of of a large molecule from two smaller…

A: An enzyme is able to catalyze the synthesis of a large molecule from two smaller molecules have to…

Q: Inference for hydrolysis of carbohydrates

Q: which of the following pertains to the tetrapeptide A-G-S-E?

Q: Drag and drop the correct terms in front of their definitions (not all terms are used). 1. the…

A: Answer

Concept explainers

Polymers

Polymers are naturally occurring or synthetically produced large molecules or compounds which are made up of series of repeating units called monomers. They are joined together by chemical bonds. The term polymer is coined from Greek roots meaning 'many parts' and are found almost everywhere from the plastics bags to the rubber of our tires to our DNA strands.

Question

Please give answer all questions with explanation

Chemistry
3. A sample of toluene in injected on a capillary column with an ID of 250 microns and a nonpolar
stationary phase. The toluene elutes with a retention time of 358 second. An unretained reference
material injected on the same column has a retention time tm of 38 seconds. The partition
coefficient K for toluene with this stationary phase is 337. Calculate the film thickness of the
stationary phase in the column.
4. On a GC column with L= 30 m, a reference sample elutes in 13.1 min with w1/2 = 15 sec. What is the
number of theoretical plates? What is the plate height?

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

introduction

VIEW

Explanation

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

For the tripeptide ala-lys-phe a) Draw the structure of the peptide you would expect at pH 1. Show all lone pairs of electrons and show formal charges. Determine the charge on the tripeptide. b) Draw the structure of the peptide you would expect at pH 7. Show all lone pairs of electrons and show formal charges. Determine the charge on the tripeptide..
Kk.254.
A peptide has the sequence Glu–His–Trp–Ser–Gly–Leu–Arg–Pro–Gly The p?a values for the peptide’s side chains, terminal amino groups, and carboxyl groups are provided in the table. Amino acid Amino pKa Carboxyl pKa Side‑chain pKa glutamate 9.609.60 2.342.34 4.254.25 histidine 9.179.17 1.821.82 6.006.00 tryptophan 9.399.39 2.382.38 serine 9.159.15 2.212.21 glycine 9.609.60 2.342.34 leucine 9.609.60 2.362.36 arginine 9.049.04 2.172.17 12.4812.48 proline 10.9610.96 1.991.99 Calculate the net charge of the molecule at pH 11 and estimate the isoelectric point (pI)(pI) for this peptide.
Give detailed Solution with explanation (don't give Handwritten answer,,)
Indicate whether each statement is true or false. (a) Thesequence of amino acids in a protein, from the amine endto the acid end, is called the primary structure of the protein.(b) Alpha helix and beta sheet structures are examplesof quaternary protein structure. (c) It is impossiblefor more than one protein to bind to another and make ahigher order structure.
How many chiral centers are there in this compound? Enter your answer as a number LOH
Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1
Identify the features of the two bonded amino acids depicted in the image. HOHH | || | | N-C-C-N-C-C CH CH₂2 CH₂2 CH₂ CH₂ I I CH₂ CH₂ NH₂+ O OH Answer Bank hydrophilic side chain hydrophobic side chain peptide bond carboxyl group amino group
What is an antioxidant enzyme? Why is catalase considered to be an antioxidant enzyme?
at a pH value of 2, the amino and carboxyl groups in an amino acid will exist as
Combining the amino acids proline and cysteine could create the peptide prolylcysteine A) True B) False