1. As you can see in Fig. 1(C), there is an interaction between A475 on SARS-CoV-2 and S19 on ACE-2. A475 is the amino acid alanine, and S19 is serine. Remember, amino acids form chains through a condensation reaction, as illustrated here: https://chem.libretexts.org/Bookshelves/Introductory Chemistry/Introductory Chemist ry (CK-12)/25%3A Organic Chemistry/25.18%3A Condensation _Reactions). Here are those structures, from Wikipedia: *Copy/paste the link into your browser* Alanine Serine H3C. HO NH, OH NH2 Skeletal formula of L Skeletal formula of L-alanine serine Ball-and-stick model Space-filing model Space-filling model Ball-and-stick model The blue portions of the structure represent nitrogen atoms, and the red portions represent oxygen. The same is true in Figures 1 and 2 in the paper. This interaction is noted to be new to SARS-COV-2 compared to SARS-CoV and is a key finding in explaining how the behaviors of these viruses differ. What kind of interactions could be occurring between A475 and S19? Mark all that apply. A. Dipole-dipole B. London dispersion C. lon-ion D. Hydrogen bond

1. As you can see in Fig. 1(C), there is an interaction between A475 on SARS-CoV-2 and S19 on ACE-2. A475 is the amino acid alanine, and S19 is serine. Remember, amino acids form chains through a condensation reaction, as illustrated here: https://chem.libretexts.org/Bookshelves/Introductory Chemistry/Introductory Chemist ry (CK-12)/25%3A Organic Chemistry/25.18%3A Condensation _Reactions). Here are those structures, from Wikipedia: Copy/paste the link into your browser Alanine Serine H3C. HO NH, OH NH2 Skeletal formula of L Skeletal formula of L-alanine serine Ball-and-stick model Space-filing model Space-filling model Ball-and-stick model The blue portions of the structure represent nitrogen atoms, and the red portions represent oxygen. The same is true in Figures 1 and 2 in the paper. This interaction is noted to be new to SARS-COV-2 compared to SARS-CoV and is a key finding in explaining how the behaviors of these viruses differ. What kind of interactions could be occurring between A475 and S19? Mark all that apply. A. Dipole-dipole B. London dispersion C. lon-ion D. Hydrogen bond

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Related questions

Q: lonization State of Histidine Each ionizable group of an amino acid can exist in one of two states,…

A: “Since there are multiple questions and it is not mentioned that which one has to be solved so I am…

Q: 17. At what concentration of the substrate would an enzyme operate at 1/6 of its maximum rate, if it…

A: We need to use Michaelis-Menten equation. It is represented as,

Q: Draw the tetrapeptide below out in full chemical structure by attaching the four amino acidsin order…

A: The given amino acids are: Tyr – Tyrosine Cys – Cystine Met – Methionine His – Histidine

Q: The shown image is a reaction diagram for the hydrolysis of peptide bonds. Appropriately substituted…

A: The combination of an amine (-NH2) functional group of an amino acid with the carboxylic acid…

Q: Consider an amino acid with the following pKa values: pKa1 = 2.71 and pK, = 9.31 At what pH value in…

A: Amino acids are amphoteric in nature due to the presence their ionizable α-amino and α-carboxylic…

Q: Identify the following amino acid at pH = 7 (aqueous form): (COO-)–CH(NH3+)–CH2–(COO-) aspartic…

A: These questions are about amino acids which are the building blocks of proteins. Various amino acids…

Q: The Michaelis-Menten equation models the hyperbolic relationship between [S] and the initial…

A: The above question is based on enzyme catalysis. We have to discuss the given conditions on the rate…

Q: A tetradecapeptide (14 amino acid residues) gives the following peptide fragments on partial…

A: So on partial hydrolysis, we will get separate amino acids peptide chain To get our main chain we…

Q: Some proteases are cysteine proteases and threonine proteases as opposed to serine proteases. What…

A: Given proteases, Cysteine proteases Threonine proteases Serine…

Q: d) Amino acids show both acidic and basic properties. Write equations to illustrate the reactions…

A: The question is based on concept of acid- base reaction. we have to show reaction of amino acid…

Q: ogen pept is rigid, take place about the N-Co and the Co-C bonds in a protein (Co is the a carbon…

Q: For an enzyme to catalyze a reaction, it must preferentially stabilize the transition state (TS) of…

A: A question based on enzyme catalysis reaction. A statement question about reaction coordinate in…

Q: The amino acid (S)-alanine has the physical characteristics listed under the structure. How does the…

A: Enatiomers: Enatiomers can be defined by saying that the optical active compounds which can rotate…

Q: Name Structure NH; CHCH, 2.20 (CO,H) 9.31 (NH3) 6.3 X 10-3 4.9 x 10-10 Phenylalanine ČO,H 2.148 *…

A: acidic strength of weak carboxylic acids :

Q: (b) Calculate the pH of 0.0005 mol dm³ ethanoic acid when its pK 4.75 CH₂COOH(aq) à CH₂COO (aq) + H*…

Q: LDA CN CH,CH,CI Br co,Et 1.2 eq.NaOEt CO,Et 2. 2 eq. Br

A: Hello. Since your question has multiple sub-parts, we will solve first three sub-parts for you. If…

Q: Draw the structure of the tripeptide, Asp-Lys-Ser, and determine its pl value.

A: Isoelectric point: The pH at which The net electric charge of the protein or peptide or an amino…

Q: c. MnO4'-+ SO32- Mn2+ + SO42- ->

Q: (a) The optical rotation [a] of aqueous samples of pure a-D-glucose D and pure ß-D-glucose were…

A: The trend in the graph is called mutarotation. Mutarotation is the change in the optical…

Q: Polysaccharides 1. pict 2. 3 What is the name of the monomer that all polysaccharides are composed…

A: Since you have posted multipart of question as per the guidelines i have solved first three subparts…

Concept explainers

Neutral Amino Acids

Amino acids which do not have any charge on them are neutral amino acids.

Globular Protein

The globular proteins refer to the shape of protein specifically spherical in nature apart from spherical form fibrous, disordered and membrane-bound proteins exist. These globular proteins are miscible in water and form a colloidal solution rather than other types which might not exhibit solubility. Many classes of the fold are found in globular proteins, which render them a sphere shape. Globular fold containing proteins usually are referred to by the term globin.

Dimer

Dimers are basic organic compounds, which are derivates of oligomers. It is formed by the combination of two monomers which could potentially be strong or weak and in most cases covalent or intermolecular in nature. Identical monomers are called homodimer, the non-identical dimers are called heterodimer. The method by which dimers are formed is known as “dimerization”.

Dipeptide

A dipeptide is considered a mixture of two distinct amino acids. Since the amino acids are distinct, based on their composition, two dipeptide's isomers can be produced. Various dipeptides are biologically essential and are therefore crucial to industry.

Question

1. As you can see in Fig. 1(C), there is an interaction between A475 on SARS-CoV-2 and S19
on ACE-2. A475 is the amino acid alanine, and S19 is serine. Remember, amino acids
form chains through a condensation reaction, as illustrated here:
https://chem.libretexts.org/Bookshelves/Introductory Chemistry/Introductory Chemist
ry (CK-12)/25%3A Organic Chemistry/25.18%3A Condensation_ Reactions). Here are
those structures, from Wikipedia:
*Copy/paste the link into your browser*
Alanine
Serine
H3C.
HO
NH,
Skeletal formula of L-
HO
NH2
Skeletal formula of L-alanine
serine
Ball-and-stick model
Space-filling model
Ball-and-stick model
Space-filling model
The blue portions of the structure represent nitrogen atoms, and the red portions represent
oxygen. The same is true in Figures 1 and 2 in the paper. This interaction is noted to be new to
SARS-COV-2 compared to SARS-CoV and is a key finding in explaining how the behaviors of
these viruses differ. What kind of interactions could be occurring between A475 and S19? Mark
all that apply.
A. Dipole-dipole
B. London dispersion
C. lon-ion
D. Hydrogen bond

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 2 steps with 2 images

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

4 An aqueous solution of an amino acid with a dissociable side chain is found to have the following side chain ratio at pH 4.0: K=[A- ]/[HA]=0.01. What is the identity of the amino acid?
Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1
The chemical structure of cysteine (C3H-NO₂S) is shown below. Highlight each atom that is in an amino group. :S H | HC-H H-C | H-N-H :0: || C. -0-H X 5 Save For Late
what intermolecular forces between the interaction of A475 and S19
All amino acids have two ionizable functional groups: an α‑amino group (average pKa of 9.4) and an α‑carboxylic acid group (average pKa of 2.2). Aspartic acid has an ionizable side chain (R group) with a pKa of about 3.8. One of the possible ionization states of aspartic acid is shown in the image. At what pH would the structure be the predominant ionization state? Consider the ionization state of all three of the functional groups.
The name carbohydrate comes from the fact that many simple sugars have chemical formulae that look like water has simply been added to carbon. (The suffix hydrate from the Greek word hydor ("water") means "compound formed by the addition of water.") The actual chemical structure of carbohydrates doesn't look anything like water molecules bonded to carbon atoms (see sketch at right). But it is nevertheless possible to chemically extract all the hydrogen and oxygen from many simple carbohydrates as water, leaving only carbon behind. If you search the Internet for "reaction of sulfuric acid and sugar" you will find some impressive videos of this. Suppose you had 300.g of ordinary table sugar, which chemists call sucrose, and which has the chemical formula C12H22O11 . Calculate the maximum mass of water you could theoretically extract. Be sure your answer has a unit symbol, and round it to the correct number of significant digits.
Please don't provide handwritten solution .....
The isoelectric point (pl) of phenylalanine is pH 5.5. Draw the structure of the major form of glutamic acid at pH values of (a) 1 (b) 5.5 (c) 11.0.
Past paper
7. Explain why 2-phenylethyl boronic acid (Compound A) is an inhibitor of chymotrypsin, which is an enzyme that catalyzes the hydrolysis of peptide linkages. What type of inhibition do you think is exemplified here? OH -CH2-CH2 B HO, Compound A
Glycine is a diprotic acid, which can potentially undergo two dissociation reactions, one for the a-amino group (-NH3), and the other for the carboxyl (-COOH) group. Therefore, it has two pKą values. The carboxyl group has a pK₁ of 2.34 and the a-amino group has a pK₂ of 9.60. Glycine can exist in fully deprotonated (NH₂-CH₂-COO-), fully protonated (NH3-CH₂-COOH), or zwitterionic form (NH3-CH₂-COO-). Match the pH values with the corresponding form of glycine that would be present in the highest concentration in a solution of th pH. fully deprotonated form NH,−CH,−COO- pH 11.9 pH 6.0 pH 8.0 fully protonated form NH3-CH₂-COOH pH 1.0 Answer Bank pH 7.0 zwitterionic form NH3-CH₂-COO-