BIOLOGY
12th Edition
ISBN: 9781260169614
Author: Raven
Publisher: RENT MCG
expand_more
expand_more
format_list_bulleted
Concept explainers
Question
Chapter 47, Problem 2DA
Summary Introduction
To determine: The countercurrent exchange system and the site where the most oxygen diffuse from water into the blood.
Introduction: Countercurrent circulation helps in exchanging dissolved substances. Therefore, to maximize the concentration of oxygen in the blood, the fishes eliminate carbon dioxide in the opposite direction that is opposite to the movement of oxygen and gets rid of carbon dioxide at the same time.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
The effect of parallel tubes on flow rate. A: the fluid reservoir is placed on top of the bench (Figure 4A) to give a pressure head. This is connected to the flow module by rubber tubing with a clamp on it. A 5-mL volumetric flask is used to collect fluid, and the time taken with different numbers of tubes in parallel is recorded on a stopwatch. (Figure 4B) The calculated flow rate plotted against the number of tubes.
a. Interpret the graph
b. What variable is the addition of more tubes in parallel affecting?
c. What are the benefits to the tissue of having more blood vessels in parallel?
The effect of length on flow rate. A: the fluid reservoir is placed on top of the bench (Figure 2A) to give a pressure head. This is connected to the flow module by rubber tubing with a clamp on it. A 5-mL volumetric flask is used to collect fluid, and the time taken with different lengths of tubes is recorded on a stopwatch. (Figure 2B) The calculated flow rate plotted against the length of tube.
a. Interpret the graph/data
b. Would you expect the length of blood vessels to change in the body as a means of controlling flow? Comment on your answer.
c. Is this likely to be a common mechanism for controlling blood flow to different tissues?
1. A recent preprint article e reported pre-clinical evaluations of an inactivated Newcastle disease virus (NDV) chimera stably expressing the
membrane-anchored form of the SARS-CoV-2 spike region (NDV-S) as a potent COVID-19 vaccine in mice and hamsters. To design the SF
Chimera, researchers combined the transmembrane domain and cytoplasmic tail of NDV F protein with the ectodomain of the SARS-CoV-2 S
region, whose sequence is as follows:
MGILPSPGMPALLSLVSLLSVLLMGCVAETGTQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFAS
TEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKH
TPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV
QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCV…
Chapter 47 Solutions
BIOLOGY
Ch. 47.1 - Prob. 1LOCh. 47.1 - Prob. 2LOCh. 47.1 - Compare evolutionary strategies for maximizing gas...Ch. 47.2 - Prob. 1LOCh. 47.2 - Prob. 2LOCh. 47.3 - Prob. 1LOCh. 47.3 - Prob. 2LOCh. 47.3 - Describe the breathing cycle of birds.Ch. 47.4 - Prob. 1LOCh. 47.4 - Prob. 2LO
Ch. 47.4 - Prob. 3LOCh. 47.5 - Describe the structure of hemoglobin.Ch. 47.5 - Predict hemoglobins oxygen affinity in various...Ch. 47.5 - Prob. 3LOCh. 47 - Prob. 1DACh. 47 - Prob. 2DACh. 47 - Prob. 3DACh. 47 - Prob. 4DACh. 47 - For a given PO2, how does oxyhemoglobin saturation...Ch. 47 - Prob. 1IQCh. 47 - Prob. 2IQCh. 47 - Prob. 1UCh. 47 - Increased efficiency of gas exchange in...Ch. 47 - Prob. 3UCh. 47 - Prob. 4UCh. 47 - Ficks Law of Diffusion states the rate of...Ch. 47 - Prob. 6UCh. 47 - Prob. 7UCh. 47 - Prob. 8UCh. 47 - When you take a deep breath, your stomach moves...Ch. 47 - Marine mammals are able to hold their breath for...Ch. 47 - Countercurrent flow systems do not occur in lungs...Ch. 47 - Respiratory organs of invertebrates and...Ch. 47 - Prob. 5ACh. 47 - During exercise more oxygen is delivered to the...Ch. 47 - Compare the operation and efficiency of fish gills...Ch. 47 - What happens when, during exercise, the oxygen...Ch. 47 - Explain how bacteria, archaea, protists, and many...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Give typed full explanation not a single word hand written otherwise leave itarrow_forwardThe effect of radius on flow rate. Figure 3A: the fluid reservoir is placed on top of the bench to give a pressure head. This is connected to the flow module by rubber tubing with a clamp on it. A 5-mL volumetric flask is used to collect fluid, and the time taken with different diameter tubes is recorded on a stopwatch. (Figure 3B) The calculated flow rate plotted against the tube radius (r) as well as against r4. a. Interpret the graph b. Is the radius a variable that is likely to change to control blood flow to different tissues? How? c. What are the implications for the control of blood flow if it is proportional to the fourth power of a variable?arrow_forwardTo explain: The reason why the movement of H* ions is faster than Ca²* ions. Also how this speed would be 2+ affected if solution was frozen.arrow_forward
- Follow directions.ocf.arrow_forwardExperiment No. 6 Milk.pdf - Adobe Acrobat Reader DC File Edit View Sign Window Help Home Tools Experiment No. 6 .. x 玩, 2 14 116% 3. Formation and Composition of Film from Milk a. Place 10 mL of fresh milk in an evaporating dish. b. Boil and observe the formation of film. Observation: c. Remove the film and then boil again. Observation: d. Test the film with Biuret's test and Acrolein test. Search Signa Convert E Edit PDF Lo Create PDF Test Performed Result with Milk Film Substance present Biuret's test Adobe PDF Pack Acrolein test Convert files to PDF anc easily combine them wit other file types Guide Questions: 1. What can you conclude regarding the chemical composition of the film formed? Select File to Convert to P e. Get 10 mL fresh milk, then acidify it with acetic acid, and repeat the above experiment. Select Fite 2. Did you get a film on boiling sour milk? 3. Explain the mechanism involved in the formation of film. Create, edit and sign PDF forms & agreements Start Free Faf B.…arrow_forwardWhy in the initial phase of fluid replacement is rapid in both isotonic and hypotonic dehydration, but it is contraindicated in hypertonic dehydrationarrow_forward
- Section E. Estimation of the Water Potential (Ψw) of Storage Tissue by Volume Change Method pls answer tysm!arrow_forwardcomponents of a relfex arcarrow_forwardNature of Science Ethical implications of research The use of animals in experiments may generate ethical issues. These are discussed in Appendix 3: Defining ethics and making ethical decisions on the accompanying website. I Figure 2.64 4 after a fixed time, the syringe is adjusted to level the fluid in the two arms of the manometer, and the volume of O2 absorbed is read off on the syringe A respirometer to measure respiration rate graduated syringe cips A and B are closed -hypodermic needle respirometer tube control tube water bath (thermobarometer) glass beads (same volume as sample in respirometer tube) 1 the respiring organisms give off Co, and absorb O, soda lime pellets- (Co, absorbent) -soda lime pellets (CO, absorbent) 2 co, is absorbed by the soda lime U-tube manometer Any change in pressure or temperature during the experiment affects the respirometer tube and the thermobarometer tube equally. 3 manometer fluid moves to the right due to the volume change caused by uptake of…arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Principles Of Radiographic Imaging: An Art And A ...Health & NutritionISBN:9781337711067Author:Richard R. Carlton, Arlene M. Adler, Vesna BalacPublisher:Cengage Learning
Principles Of Radiographic Imaging: An Art And A ...
Health & Nutrition
ISBN:9781337711067
Author:Richard R. Carlton, Arlene M. Adler, Vesna Balac
Publisher:Cengage Learning