Q: 1. On/ Off switch Select 2. Eyepiece/ Ocular lens ( Select ) 3. Arm I Select) 4. Nosepiece I Select)…
A: Compound microscopes are analytical instruments used to visualize the enlarged images of small…
Q: What is ONE common theme that you noticed between the story of Henrietta Lacks and the Tuskegee…
A: Medical or clinical research has helped us advance medical knowledge and technologies. Medical…
Q: What are operators?
A: The change in the external and internal environment of a cell, allows the cell to respond. It is…
Q: A patient has been ordered dronabinol tetrahydrocannabinol for nausea. The provider orders 2.5mg/Kg…
A: Given:Patient weight = 121 lbsDrug order = 2.5 mg/kg orally every 2 hours after chemotherapyDrug…
Q: Please choose answer(s) from the three at the bottom of the question
A: Introduction :- True breeding, also known as pure breeding, refers to a population of organisms…
Q: Please provide examples of the (Hardy-Weinberg Law P^2 + 2pq + q^2 = 1)
A: There are two equations necessary to solve a Hardy-Weinberg Equilibrium question:?? + ?? = 1??² +…
Q: The p value is: Question p>0.995 0.9>pp<0.1 p<0.005
A: Genetics is the study of genes, their interactions, and the effect of environment on genes. Broadly…
Q: Instruction: Fill up the table by computing the dominant alleles, recessive alleles and the…
A: According to Hardy Weinberg equilibrium- p2 + 2pq + q2= 1 and p+q= 1 p = frequency of the dominant…
Q: Why death is a return?
A: Death : 3 types Clinical death: when the heart stop beating Brain death: absence of brain activity…
Q: Question 28 The effect of sympathetic stimulation on the eye is: O Pupillary dilation, muscular…
A: The iris regulates the amount of light that reaches the eye by opening the pupil and shutting it. To…
Q: you can't choose two answers which one is it B or D?
A: The respiratory system is a crucial body organ system composed of respiratory organs, respiratory…
Q: Question 4 (1 point) Metabolism refers to burning food during physical activity like running.…
A: The true answer is... All of these (e)
Q: Abstract data types are one of the most difficult ideas to comprehend (ADTs). Are there benefits to…
A: ADTs are mathematical representations of data types. An abstract data type's behaviour is described…
Q: What is control group? Explain the purpose of a control in an experiment.
A: It is required to define a control group and the purpose of control in an experiment. The scientists…
Q: Question 4
A: Introduction: In the binomial nomenclature system of identifying organisms, each species is given a…
Q: Use the Information below to answer the question. Compound A B с Binds to receptor Yes Yes No…
A: Signal transduction is described as a process through which molecular signals are transmitted from…
solve a given problem
Step by step
Solved in 2 steps
- what is the full name of the TISSUSE TYPE at the end of the arrow for letter F? F1) Does this look like any other lettered structure on this photomicrograph? If yes, which one and how are they similar.61 identify the primer 3' 5' a 5' 3' C e f a 5' 3' 3' 5' Select an answer and submit. For keyboard navigation, use the up/down arrow keys to select an answer. a a b b e f a Save UnansweredAa Po AaBbCcDc AaBbCcDdEe AaBbCcDdE AaBbCcDdE AaBbCcDdE BIUVab x, x A ev A 三==|這、|の Caption Emphasis Heading 1 Heading 3 Heading 4 Style Pane (a) Complete the table, using a letter D, R or B, to show whether each statement applies to: Fo DNA only (D) TA2G – Completed forms must be available for Open Awards external moderation purposes. Page 6 of 15 > T | RNA only (R) Both DNA and RNA (B) Statement D or R or B Contains thymine Contains ribose Consists of two chains connected to each other with hydrogen bonds Has a sugar-phosphate backbone Has four different nitrogenous bases Contains a pentose sugar Is found in the nucleus and cytoplasm English (United Kingdom) Focus 目民 2490 words +1
- Which of the following would be the correct Haworth projection of a-D-Talose (linear form is in the left side)? * CHO CH,OH CHOH OH HO HO -H- он OH OH HO OH OH OH OH C. CH,OH CH,OH H- он он OH OH CHOH OH OH он O D3 attempts left Check my work Be sure to answer all parts. Re Consider the following sequence of DNA: 3'-AGA CCC-5'. a. What dipeptide is formed from this DNA after transcription and translation? b. If a mutation converts CCC to CCA in DNA, what dipeptide is formed? Gu c. If a mutation converts CCC to CGC in DNA, what dipeptide is formed? d. If a mutation converts CCC to GCC in DNA, what dipeptide is formed? a. b. c. d.For letter A, pls ILLUSTRATE (create an illustration or drawing) the DILUTION SERIES of the problem just like the sample on the 2nd image. Please read the instructions carefully as I have already posted this twice and the experts just copy-pasted the answers from my first post. I don't want to waste another post question for this one. Again, I NEED AN ILLUSTRATION and not just the computation/explanation through words so I can properly visualize the problem. WILL UPVOTE if I get what I need.
- For a DNA sample, the OD value at 260nm = 0.125, and the OD value at 280nm 0.065. Purity of DNA - OD 260/280 %3D Concentration of DNA = Abs x 50 µg/ml x dilution factor (100) 0.125 x 50 µg/ml x 100 = Edit View Insert Format Tools Table 12pt v Paragraph v BIUA 2 T'vt (5 a 1 dao) - Google Chrome edu.om/mod/quiz/attempt.php?attempt=2334320&cmid=1127808 SQU E-LEARNING SYSTEM (ACAI الوقت المتبقي 0.175mm .e O In the DNA extraction experiment, the separation of DNA from its packaging protein can be achieved by the addition of Detergent aO 1.00 Salt b O هذا السؤال Ethyl alcohol cO Papain powder .d O Cold water Le O In paramecium, osmoregulation occurs through 3 Activate Windowssk Macronucleus Goaotings to acttivate do nere to search 6. 70°F Mostly sunny 9:05 ENG 12/18 f2 O f3 O f4 O f6 O f8 end f7 0 F10 insert f9 D F12 T num IA break @ %24 & 8 2 3 r 4 5 6 7 8 A 9 9 R Y ! U S F G J K +|| 回 Q 以 46. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…
- Horizontal sequence :RIVL Vertical sequence:FMK Scoring rules: g/o = -3, g/e = -1, match or mismatch - from PAM250 substitution matrix below. SW algorithm. 1. Complete the scoring matrix. Scoring matrix with PAM250 scores: R I V L F M K 2. Set up, initialize and complete the SW matrix. 3. Retrace, align and score alignment(s). Use the arrows and circles for the matrix and path(s). R I V L F M K Align and score all optimal alignments here. PLZ the arrows and circles for the matrix and path(s) AND SHOW ALL possible Alignment Here the following points…Can I have some help with this please ,I just need to know what to match with what for this slide , thank you!Horizontal sequence :RIVL Vertical sequence:FMK Scoring rules: g/o = -3, g/e = -1, match or mismatch - from PAM250 substitution matrix below. NW algorithm. 1. Complete the scoring matrix. Scoring matrix with PAM250 scores: R I V L F M K 2. Set up, initialize and complete the NW matrix. 3. Retrace, align and score alignment(s). Use the arrows and circles for the matrix and path(s). R I V L F M K Align and score all optimal alignments here. PLZ the arrows and circles for the matrix and path(s) AND SHOW ALL possible Alignment Here the following…