Q: Which of the following are considered emergent properties of life? Check all that apply. Electrons…
A: ANSWER:- Release of energy from glucose during metabolism Three-dimensional structure of different…
Q: Which part of the brain helps prioritize sensory information?
A: As we know brain is a network of billions of neurons which carry information and transport them in…
Q: WHAT IS Humoral Immunity
A: Active immunity is the immunity induced in entities by the exposure of antigens. It is mediated by…
Q: statement is true. Both statements are false. 1. Epigenetics does not consider how exposure to…
A: Epigenetics is the study of how your behaviour and environment can influence how your genes…
Q: GQ#15: What do the following terms mean? Write your best answer on the space provided after each…
A: Evolution is the change in characteristics pf species from generation to generation. There are four…
Q: Structurally, a virus consists of a. DNA and RNA b. Capsid c. Protein molecule at its core d.…
A: The virus are classified as intermediate form in between the living and non-living materials. They…
Q: genotype (you hy unlisted components are wildtype): repp lacl* lacP+ laco* lacz*/ repPlacls lacP+…
A: * The lac operon consists of structural genes that codes befor proteins and regulatory genes that…
Q: Once in human cells, which of the following statements might best describe how COVID19 replicates?…
A: Coronaviruses make full-length copies of their genomic RNA, which are integrated into freshly formed…
Q: If you had a template sequence of AACCGTTA, how many flushes of nucleotides would it take to get the…
A: DNA sequencing is a process which encompasses biochemical methods gor determining the order of the…
Q: Icefish live in the extremely c They are the only vertebrates bin. They have a large heart a their…
A: A new study has discovered a concerning link between warmer seas, declining sea ice levels, and…
Q: Describe the traits common to all fishes.
A: Fishes are diverse. They have evolved to live successfully in underwater environment, from streams…
Q: Which of the following replication enzymes will most likely be involved in COVID19 RNA replication?…
A: Coronaviruses (CoVs) are the most common type of virus in the Nidovirales order, which comprises the…
Q: What molecules are released by activated helper T cells? Note: This is a multiple question, choose…
A: As they are necessary for practically all adaptive immune responses, helper T cells are perhaps the…
Q: Which protein in erythrocytes is responsible for capturing oxygen in the air and delivering it to…
A: Red blood cells, also known as red cells, red blood corpuscles, erythroid cells, or erythrocytes,…
Q: Which of the following would be the first step in biosynthesis of a virus with a - (minus) strand…
A: D. Synthesis of double stranded RNA from an RNA template
Q: Viruses occur in a. living state only b. both living and non-living states c. non-living state…
A: Virus is infectious microbe which contains a segment of nucleic acid (either DNA or RNA). Viruses…
Q: 4. What is the effect of the amount of time spent on social media on a person’s anxiety level?…
A: As we know that anxiety is one of the mental disorder and symptoms of anxiety are sweating , panic ,…
Q: 1. Marsupials are unusual mammals because they carry their young in a oub. 2. Like most mammals,…
A: Marsupials are the members of mammalian infraclass Marsupialia.
Q: A tumor suppressor gene (TSG) codes for a protein that is part of the system that regulates cell the…
A: Answer :- Option (C) is correct. - The TSG is downregulated due to hypermethylation which may lead…
Q: Enter the corresponding section of mRNA produced from the following section of DNA template strand:…
A: DNA or Deoxyribonucleic acid is the genetic material for most higher organisms and some viruses. RNA…
Q: In humans, the genes for red-green color blindness (R = normal, r = color blind) and hemophilia A (H…
A: Given: In humans, The genes for red-green color blindness (R = normal, r = color blind) and…
Q: List some causes of the ongoing decline in amphibian diversity.
A: Introduction Amphibians are tetrapod animals that are ectothermic and belong to the class Amphibia.…
Q: E ion A formula for a cough syrup contains 1/9 gr of codeine phosphate per teaspoonful. How many…
A: 1 teaspoon= 5 ml 1.5 pint = 852 ml cough syrup contains 179 gm of codeine phosphate per…
Q: What are the adaptive structures of the ectoparasites and the endoparasites? Compare and contrast…
A: Any organism that obtains its nutrition from the inner surface or the outer surface of the host is…
Q: B. Classify the flowers whether they are regular or irregular, complete or incomplete. Observe and…
A: The external morphology of plants helps in distinguishing them from other plants. The flowers of the…
Q: Explain how snakes are related to lizards
A: Snakes and lizards are closely related to each other that belongs tothe order squamata of the…
Q: What would happen if the polydnavirus mutated and no longer depressed the caterpillar’s immune…
A: Polydnavirus is a kind of insect virus belonging to the polynaviridae family. This virus can form a…
Q: O O O When CAMP is formed, it will activate: O Protein Kinase C O Protein Kinase A O G-protein O…
A: The immune system's controller, cAMP. Adenylate cyclases convert adenosin-triphosphate to cAMP.…
Q: DNA transcription may be selectively regulated through alteration of the rate of protein synthesis…
A: Transcription is the process by which the information in a strand of DNA is copied into a new…
Q: In corn plants, ragged leaves (R) are dominant to smooth leaves (r). If two ragged leaf plants are…
A: 4th option is correct i.e. Rr, Rr and rr. In corn plants, ragged leaves (R) are dominant on smooth…
Q: Immunohistochemistry is routinely used to determine specificity and identification of disease.…
A: Immunohistochemistry is a immunostaining process in which antigens in the cells are identified by…
Q: How do viroids and prions differ from viruses?
A: A virus is a small infectious agent which replicates only within an organism's live cells. Viruses…
Q: Contrast endotoxins with exotoxins.
A: Introduction :- Endotoxins are lipopolysaccharide-protein complexes that are produced when a cell…
Q: Comment on the accuracy of the aminoacylation during the charging of tRNA to ensure the fidelity of…
A: Amino acid activation or commonly known as tRNA charging, refers to the attachment of an amino acid…
Q: 1. A biologist wants to make a scale model of a plant cell that is 30 cm across.M How large would…
A:
Q: 2. The genotype of F₁ individuals in a tetrahybrid cross is AaBb assortment of these four genes,…
A: A trait is characteristic feature that is unique to particular individual. A tetrahybrid cross is a…
Q: Many drugs work by interfering with the inactivation of neurotransmitters once they gave been…
A: The body possesses several chemical messengers which are known as neurotransmitters. These…
Q: If you mated an F' bacterial cell with lacl+ lacP+ lacO+ lacZ+ lacY+ on the bacterial chromosome and…
A: β-galactosidase gene (PbBGal2A) from Paenibacillus barengoltzii expressed in E. coli; the enzyme…
Q: Both cartilaginous and bony fishes have______ . a. jaws d. a swim bladder b. a bony skeleton e. a…
A: The term vertebrate is derived from the word vertebrae, which refers to the bones that make up the…
Q: According to the progressive, or escape, hypothesis, viruses (a) appeared before the three domains…
A: Virus is a relation between living and non living world and it is infectious. This is because ,…
Q: What are the possible interferences or sources of variability in the assay? How do these…
A: In laboratory medicine, mining, pharmacology, environmental biology, and molecular biology, an assay…
Q: The binding between the substrate and the active site of the enzyme: O Is very specific O Resemble…
A: Enzyme is a biocatalyst. It speeds up the reaction.
Q: The fact that a prokaryote has the ability to make a new protein that is placed in the cell membrane…
A: Prokaryotes are organisms in which cell do not have nucleus and organelles. Prokaryotes are further…
Q: In fruit flies, the allele for long wings (L) is dominant to the allele for short wings (l). If a…
A: The alleles are the alternative forms of a gene that are located on the same locus of a homologous…
Q: transalational control is dependent on the stability of mRNA molecules
A: Translational mechanisms can also be used to modulate gene expression. These techniques are…
Q: Dideoxy sequencing is one of the most important methods for DNA sequencing. What could be the impact…
A: The biological methods for establishing the arrangement of the nucleotides in a DNA oligonucleotide…
Q: Which of the following definitions are consistent with the scientific meaning/use of the word…
A: A research proposal is a document that defines the objectives of the research as well as the methods…
Q: 29. Sympatric speciation describes populations that a have sexual dimorphism b) look the same…
A: Question number 29. The type of speciation where reproductive isolation occurs between the…
Q: 3) Whole-mount in situ hybridization can be used to test for the function of non-coding DNA region.…
A: * Whole mount in situ hybridization is a tool that aids for temporal and spatial dissection of gene…
Q: Hydrogen bonds are important in DNA replication and transcription. They are relatively weak chemical…
A: Introduction 1. Hydrogen bonds are a type of attractive interaction between an electronegative atom…
Trending now
This is a popular solution!
Step by step
Solved in 3 steps
- Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSAIndicate whether each listed solid-phase peptide synthesis step is performed one time or performed repetitively. React amino-protected amino acid with solid support [Select] React amino-protected amino acid with DCC (dicyclohexyl carbodiimide) [Select] React amino-protected and carboxyl-activated amino acid with growing peptide chain [Select] Deprotect amino acid sidechains [Select]Amino Acid: Asn-Met-Ser-Ile-Phe-Arg-Cys-Tyr-Lys What is the one letter code of this amino acid and what is its classification? What is the side chain description (e.g. amide, aromatic etc.)