A protein has the amino acid sequence DSRLSKTMYSIEAPAKLDWEQNMAL How many peptide fragments would result from cleaving the sequence with each reagent. cyanogen bromide: 3 trypsin: 4 chymotrypsin: 3 Incorrect Which of these three reagents gives the smallest single fragment (in number of amino acid residues)? Otrypsin cyanogen bromide Ochymotrypsin Incorrect

A protein has the amino acid sequence DSRLSKTMYSIEAPAKLDWEQNMAL How many peptide fragments would result from cleaving the sequence with each reagent. cyanogen bromide: 3 trypsin: 4 chymotrypsin: 3 Incorrect Which of these three reagents gives the smallest single fragment (in number of amino acid residues)? Otrypsin cyanogen bromide Ochymotrypsin Incorrect

Biochemistry

9th Edition

ISBN:9781319114671

Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Chapter1: Biochemistry: An Evolving Science

Section: Chapter Questions

Problem 1P

See similar textbooks

Related questions

Q: Question. In case of accidents, what are the first aid treatment for the following: a. Cuts b. Burns…

A: The immediate asistance provided to a person who has sustained an accidental injury is called first…

Q: each of these 5 tissues and color the images using the legend/colors: the nucleus (blue), Cytoplasm…

A: Introduction The cell is the basic, structural, and functional unit of life in all biological…

Q: Fem. 56 years old with a history of diabetes II, hypertension, obese starts 5 days ago with a dry…

A: Diseases often require scrutiny of the signs and symptoms that are derived out of the pathological…

Q: a. Explain the basis for combined therapy.b. What are some reasons it could be helpful to use…

A: Combination therapy is a therapeutic method in which more than one therapy is administered to the…

Q: Hi, please help me with my assignment. All questions please. 1. The metabolic precursor for the…

A: Hi, thank you for posting the question on Bartleby. As per the guidelines we can answer up to three…

Q: Please help with the attached.

A: Key teaching points regarding pseudoephedrine should include the following: - Prescribing reason -…

Q: PLEASE HELP ASAP. If some structures are not in the picture it's okay

A: Introduction:- The female reproductive system of rabbit made up of a one pair of ovaries, small…

Q: The recombination frequency of the five loci are as follows. Map the 5 different loci, showing their…

A: Recombination frequency It refers to the frequency of a single crossing of chromosomes between two…

Q: 1. Create the equation where life expectancy of a person is positively affected by the number of…

A: In any experiment type and number of variables play a very important role. In experiments some…

Q: Column B a. Urinary b. Reproductive c. Endocrine Answer Column A 1. Support visceral organs 2.…

A: A group of similar cells that perform a specific function is referred to as tissue. An organ is a…

Q: differentiate phototherapy and exchange transfusion of hyperbilirubinemia

A: Jaundice is a clinical condition in which there occurs yellow colouring of the skin and eyes brought…

Question

Pls help. In the chymotrypsin I have alreasy answered 5, 4, 3, 2, 1. I don.t know whats the matter, but it doesn.t want to give me the answer.

A protein has the amino acid sequence
DSRLSKTMYSIEAPAKLDWEQNMAL
How many peptide fragments would result from cleaving the sequence with each reagent.
cyanogen bromide: 3
trypsin: 4
chymotrypsin: 3
Incorrect
Which of these three reagents gives the smallest single fragment (in number of amino acid residues)?
Otrypsin
O cyanogen bromide
Ochymotrypsin
Incorrect

< Question 17 of 18 >
A protein has the amino acid sequence
DSRLSKTMYSIEAPAKLDWEQNMAL
How many peptide fragments would result from cleaving the sequence with each reagen
cyanogen bromide: 3
trypsin: 4
chymotrypsin: 3
Incorrect
Which of these three reagents gives the smallest single fragment (in number of amino a
Otrypsin
O cyanogen bromide
Ochymotrypsin
Incorrect
Feedback
Attempt 8
T
You have not correctly determined
the number of peptide fragments
resulting from cleaving the sequence
with chymotrypsin. Cleaving the
protein with cyanogen bromide
yields a two-residue fragment.
However, cleaving the protein with
another of the reagents yields a
one-residue fragment.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Site specific peptide digestion

VIEW

Proteolytic digestion of the given peptide by given proteases

VIEW

Answers

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 3 steps

SEE SOLUTION Check out a sample Q&A here

Similar questions

use one-letter code for amino acid if needed what is the overall amino acid sequence?
A tetradecapeptide (14 amino acid residues) gives the following peptide fragments on partial hydrolysis. From this information, deduce the primary structure of this polypep- tide. Fragments are grouped according to size. Pentapeptide Fragments Tetrapeptide Fragments Phe-Val-Asn-Gln-His Gln-His-Leu-Cys His-Leu-Cys-Gly-Ser His-Leu-Val-Glu Gly-Ser-His-Leu-Val Leu-Val-Glu-Ala
Which of the following amino acids would you least expect to find on the surface of a water-soluble protein? Explain I Serine Glutamat Lysime Threonine
A peptide has the sequence Glu-His–Trp–Ser-Gly–Leu-Arg-Pro–Gly The pK, values for the peptide's side chains, terminal amino groups, and carboxyl groups are provided in the table. Amino acid Amino pKa Carboxyl pKa Side-chain pKa glutamate 9.60 2.34 4.25 histidine 9.17 1.82 6.00 tryptophan 9.39 2.38 serine 9.15 2.21 glycine 9.60 2.34 leucine 9.60 2.36 arginine 9.04 2.17 12.48 proline 10.96 1.99 Calculate the net charge of the molecule at pH 3. net charge at pH 3:
For each amino acid, show the structure, 1-letter abbreviation, 3-letter abbreviation, class (non-polar, polar, positive or negative), special props, side chain pKa)
Indicate which of the amino acid residues in the following peptide sequence contains a group that has a positive charge for its most likely charge state at pH 10. Asp-Tyr-Lys-GIn-Thr-Ile-Phe-Met-Ser (If none of the amino acids fit the criterion, select "none".) Asp Tyr ооооооооо Lys Gln Thr lle Phe Met Ser none
29. Amino Acid Chemistry: Using the amino acid chart provided..Ala-Lys-Cys & give the isoelectric point for the tripeptide. Table 23.2 The pK, Values of Amino Acids pk, a-COOH a-NH3* Amino acid side chain Alanine 2.34 9.69 2.17 9.04 12.48 Arginine Asparagine 2.02 8.84 3.86 Aspartic acid Cysteine 2.09 9.82 1.92 10.46 8.35 Glutamic acid 2.19 9.67 4.25 Glutamine 2.17 9.13 Glycine 2.34 9.60 1.82 9.17 6.04 Histidine 2.36 9.68 Isoleucine Leucine 2.36 9.60 2.18 $ 95 10.79 Lysine 2.28 9.21 Methionine 16 9.18 Phenylalanine 1.99 10.60 Proline 2.21 9.15 Serine 2.63 9.10 Threonine 2.38 9.39 Tryptophan Tyrosine 9.11 10.07 2.20 2.32 9.62 Valine O something else! 5.14 O 8.65 something else! 5.81 9.02 9.57
Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA
Draw a peptide for cys-asn- pro-gly (Using the same format in picture)
The peptide below -NH-CH- H3N-CH- CH3 NH-CH- -NH-CH- -O- -NH-ÇH- CH2 CH2 CH2 HN-ç=NH, NH2 CH2 CH2 CH Ho-CH, C-OH H,C CH3 needs to be separated from a second peptide with a primary sequence ADES. At what pH range would it be possible to separate the peptides? O 0- 2.0 O 2.5 - 3.5 O 4.0 - 9.0 O 13.0 -14.0 о 10.0-12.0
A peptide has the sequence Glu-His-Trp-Ser-Gly-Leu-Arg-Pro-Gly The pK₁ values for the peptide's side chains, terminal amino groups, and carboxyl groups are provided in the table. Amino acid Amino pKa Carboxyl pKa Side-chain pKa glutamate 9.60 2.34 4.25 histidine 9.17 1.82 6.00 9.39 2.38 9.15 2.21 9.60 2.34 9.60 2.36 9.04 2.17 10.96 1.99 tryptophan serine glycine leucine arginine proline Calculate the net charge of the molecule at pH 3. Calculate the net charge of the molecule at pH 8. 12.48 net charge at pH 3: net charge at pH 8:
use one-letter code for the amino acid if needed what is the sequence of peptide 1?