7. Determine the standard free energy change, AGF°, for the formation of S² (aq) given that the AGF° for Ag*(aq) and Ag2S(s) are 77.1 kJ/mole and -39.5 kJ/mole respectively, and the solubility product for Ag2S(s) is 8 xx 10-51.

7. Determine the standard free energy change, AGF°, for the formation of S² (aq) given that the AGF° for Ag*(aq) and Ag2S(s) are 77.1 kJ/mole and -39.5 kJ/mole respectively, and the solubility product for Ag2S(s) is 8 xx 10-51.

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Related questions

Q: Identify solubility of Amine group in water. Justify your answer. Compare solubility in water for…

Q: You have been given a mixture of lysine, histidine and cysteine. The isoelectric point of the amino…

A: The mixture of amino can be separated by electrophoresis technique. This method is based on pH…

Q: lonization State of Histidine Each ionizable group of an amino acid can exist in one of two states,…

A: “Since there are multiple questions and it is not mentioned that which one has to be solved so I am…

Q: I am given an unknown sample of an amino acid. On testing it, I find that its R group is polar, and…

A: Presence of electronegative atom like N and O atom in the benzene side chain makes them polar in…

Q: When an amino acid has a negative charge coming from the carboxylic acid or a positive charge coming…

A: Explanation: The point at which an amino acid has no net electrical charge is known as its…

Q: Eucalyptus essential oil reduces dental issues such as cavities due to the following properties:…

A: Eucalyptus essential oil reduces dental issues such as cavities. Eucalyptus oil is a…

Q: Answer the following problem and show your detailed solution and explanation. The tripeptide…

Q: Consider the ring structure of b-d-glucose. It will give a positive test reducing sugars. Describe…

A: The ring structure of glucose is not stable. there is a continuous exchange between open-chain and…

Q: Protease enzymes are a type of protein made up of: Select one: Peptide Carbohydrates Pepsin Amino…

A: Proteins that function as biological catalysts are known as enzymes. Catalysts help to speed up…

Q: Answer the following questions on the basis of the free energies of formation at 25°C shown in the…

A: (a) The mentioned peptide bond formation reaction can be represented as:…

Q: Which of the following is NOT a weakness of the Meyer Overton theory? O does not explain why certain…

A: The Meyer-Overton speculation is the hypothesis of sedative activity which suggests that the…

Q: None

A: When a His side chain needs to form an ionic interaction with a chloride ion for protein X to be…

Q: 1. Fill In the blank with the correct terms. Term for elemental cations that act as enzymatic…

A: Enzymes are proteins that allow reactions within the body to occur faster and with less energy. By…

Q: QUESTION 19 Briefly explain why there are + and - charges in the amino acid structures in the table…

Q: HCl(g) deltaG=-95.3O2(g) deltaG=0 H2O(g) deltaG=-228.6Cl2(g) deltaG=0

A: Finding equilibrium constant.

Q: given a solution of alanine at pH 9.00, draw the structure of the species present in appreciable…

A: The given amino acid is alanine. pH of the given alanine solution = 9.00The Henderson-Hasselbalch…

Q: The image below is a positive ionization mode Electrospray ionization-mass spectrum (ESI-MS)…

A: A multiple choice problem based on mass spectrum, which is to be accomplished.

Q: I. II. II.

Q: 1. Draw the structure and interaction that occurs between the following R groups of amino acids in…

A: a)The interaction that can occur between the R groups of asparagine and serine is a hydrogen bond.…

Q: What are some good memorization stategies?

A: Memorization is very important for every human being. In this era of competition, where everyone…

Q: Part A co,- Express your answer as a chemical formula or an ion. ? ΑΣφ DA chemical reaction does not…

A: According to Bronsted-Lowry acid and base theory, an acid is a proton donor and base is a proton…

Q: One of the important reactions in the biochemical pathway glycolysis is the reaction of…

A: Options - C ∆G = - 2.1 KJ Given : ∆G° = 1.7 KJ = 1.7 ×10^3 J R = 8.314J/K.mol T = 37 °C =…

Q: 1. Calculate the observed rotation, a one would measure for a 20.0% (m/v) D-glucose solution if a 2…

A: We have find out the observed rotation of D- glucose and L- glucose solution. Note -As per our…

Question

What’s the answer for this

7. Determine the standard free energy change, AGF°, for the formation of S2(aq) given that
the AGF° for Ag* ag) and Ag:S(s) are 77.1 kJ/mole and -39.5 kJ/mole respectively, and the solubility
product for Ag2S(s) is 8 xx 10-51.
8. A reaction has AH° = 100 kJ/mol and AS°=250 J/mol·K. Is the reaction spontaneous at room
temperature? If not, under what temperature conditions will it become spontaneous?

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 2 steps with 1 images

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

None
Is the answer 16.1 or 16.8?
The pka of ascorbic acid is 4.2 at 24C. At what pH is the ratio of the deprotonated form to the protonated form 10:1? Prove using the Henderson-Hasselback equation. How to resolve this.
3b) please see attached
Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1
The chemical structure of cysteine (C3H-NO₂S) is shown below. Highlight each atom that is in an amino group. :S H | HC-H H-C | H-N-H :0: || C. -0-H X 5 Save For Late
Identify the features of the two bonded amino acids depicted in the image. HOHH | || | | N-C-C-N-C-C CH CH₂2 CH₂2 CH₂ CH₂ I I CH₂ CH₂ NH₂+ O OH Answer Bank hydrophilic side chain hydrophobic side chain peptide bond carboxyl group amino group
(Thanks for the help if you can break down the steps and provide drawings(needed) during the answer since i am trying to see if i have solved this in the right way not copy :)) Draw the heme environment in oxymyoglobin and explain how the geometric data for the attached oxygen molecule may be understood. Fe O (bond length) = 1.809 Å; O-O (bond length ) = 1.246 Å; Fe - O - O (bond angle) = 123 \deg
Determine the molecular formula and calculate the molar mass (in g/mol) of histidine, the essential amino acid. The formula should be entered as CwHxNyOz (for example C2H2N2O2, omit coefficient if equal to 1), followed by other element if any. Molecular formula is . ord NH₂ N H molar mass is OH
Differentiate and explain the chemical basis of the Kjeldahl, Lowry and Bradford techniques that can be used to quantitate proteins in quality control and research.