1. Given k sequences, design an algorithm to find the most conserved motif among all (l, d)-motifs.

What is a motif? Why is it useful for computer programs to identifyfunctional motifs within amino acid sequences?

1. Explain why the primary structure sequence -Lys-Leu-Trp-Asp- may promote a-helix formation while the sequence -Lys-Leu-Trp-Arg- may inhibit it.

Give the sequence of unpaired bases that would be sticky with the following sequences:(a) GGTAC (b) ACCCA (c) GTGTC

show a

1) You are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide |protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280nm or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280nm? Select the best answer. a) Measuring absorbance at higher wavelengths, like 595nm or 562nm, is more accurate than measuring absorbance at 280nm. b) The Bradford…

For each polypeptide derived in the following sequences: 5' CAA GAG GUA UCC UAC AGA 3' 5' GUC AUC UGG AGG GGC AUU 3' 5' CUA UGC AGU AGG ACA CCC 3' 1. Draw the structure of each polypeptide.  2. Label the amide bonds. 3.  Identify the N-terminal and C-terminal amino acids. 4. Write the name of each polypeptide.

10.Suppose the following base sequence was found Complete the following: (10 points) nscript: 3' TACAGTTAAGGCTCCACTGTTA 5' 5' 3' ino Acid Sequence (ex. Met-Trp- and so on) Second letter U A G UUU) Phe UCU UAU Tyr UGU Cys UAC J Ser UAA Stop UGA Stop UUC J UGC J UCC UCA UCG U UUA Leu UUG. UAG Stop UGG Trp G CUU CUC CUA CUG CU ССС ССА CG CAU CGU U CAC His CAA CGC Arg CGA Leu Pro Gln CAGJ CGG AUU ACU AAU AUC le A AUA ACC АCА AAC FAsn AAA AGU Ser AGC Thr AGG Arg G AGA AUG Met ACG AAGLYS GUU GUC GUA GUG GCU GCC GCA GCG GAUT GẠC, Ala GAA) GGU GGC Gly U Asp G Val GGA GAG Glu GGG First letter Third letter

131.) How many different sequence possibilities are there for a double-stranded RNA polymer that is 6 bases long? A) 64=(25) B) 192= (3x 25) C) 1296= (6) D) 4096= (45) E) 8192= (2x45)

Suppose that there is an unknown protein that underwent Edman sequencing method. From N- terminal determination, a biochemist found out that there are two N-terminal amino acid residues, V and G. What is the original sequence of the protein given the following peptide fragments: after digestion with Chymotrypsin: G-L-S-R-G-M-w V-A-L-F Q-L-Y L-R-V-W G-M-V-E-A-D-I-P K-S-P-E-M-T-W R-M-A-S-E-K-P-G-H after digestion with Trypsin: P-G-H V-W-G-M-V-E-A-D-I-P M-A-S-E-K G-M-W-Q-L-Y-L-R S-P-E-M-T-W-R G-L-S-R V-A-L-F-K after digestion with Cyanogen Bromide: T-W-R-M W-Q-L-Y-L-R-V-W-G-M V-E-A-D-I-P A-S-E-K-P-G-H V-A-L-F-K-S-P-E-M G-L-S-R-G-M