3-2-1 Code It
6th Edition
ISBN: 9781337660549
Author: GREEN
Publisher: Cengage
expand_more
expand_more
format_list_bulleted
Concept explainers
Videos
Question
error_outline
This textbook solution is under construction.
Students have asked these similar questions
What is the resulting polypeptide: _______________________________________________________?
6. Refer to the figure answer the following questions.
Alignment
Hide Colors
View Alignment File
CLUSTAL W (1.83) multiple sequence alignment
Human_AA
Oyster AA
Corn_AA
-MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50
-QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-
MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60
--WSDIAAECERFLGPM 52
:..
GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110
Human_AA
Oyster AA
Corn_AA
GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112
GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114
:: *.. :::.:. : .*:
*...
DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169
DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170
DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163
Human_AA
Corn_AA
:: *
Figure: Sequence alignment
a) How many different species are used as the source of sequence
in this analysis?
I. two
II. one
III. three
IV. four
b) What does the (*) mark mean in…
Please help me with part one
questions 3,4,5
Thank you
PDF link https://www.cusd80.com/cms/lib/AZ01001175/Centricity/Domain/8922/eofad.pdf
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- not writing assignment!!!!!!!!! could you make powerpoint presentation subtopics for Fluorescent Protein-Based Biosensors and Their Clinical Applications example of what i want is below - just follow the format no need to do it i just need a format for the topicarrow_forwardPlease answer all for the UPVOTE. Write TRUE if the statement is correct, but if false, change the underlined word or group of words to make the whole statement true. a. Cell is a membrane-bounded unit that contains RNA and cytoplasm. b. Membranes are exquisitely sensitive to chemical messages, detecting them with receptor proteins on their surfaces that act as antennae. c. The cytoplasm of a cell contains ions and molecules, such as sugars and amino acids, dissolved in water.arrow_forwardPlease answer within 10 minutes.arrow_forward
- Hi there- I really need help with creating a dichotomous key. I am stuck and cannot figure this out. Can you show me how to create a dichotomous key using the household items: butter knife, sharp kitchen knife, scissors, pen, and pencil. thank you!!arrow_forwardCan someone please read the question very well and check my boxes if I have filled up correct. The first column was given, the blue color are my answers. Please check and let me know if correct if not please help me to fix it. Thank youarrow_forwardThe following statements are either accurate as written or contain some errors. You need to rewrite each as an accurate statement. Make sure that you do not change the material the sentence is about. Highlight or underline any changes that you make to statements. Thank you! 1. Cancer is caused by a single mutation in either a tumor suppressor gene or an oncogene. The reason that cancer rates increase with age is because our immune system is better at fighting mutations. 2. Pluripotent is the term used for cells that have already differentiated into all cell types within an organism. 3. Phenotypic variance is partitioned into genetic variance and additive variance. This also indicates that the amount of variance in the phenotype of individuals with the same genotype is solely based on heritability values.arrow_forward
- Mutated DNA Sequence #3 T A C A C C T T A G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________ Mutated DNA Sequence #4 T A C A C C T T G G C G A C T A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ______________________________arrow_forwardWhat was the rote of administration for Levaquin in the treatment of the UTI?arrow_forwardGive explanation of correct answer and explanation of incorrect answers please and get like otherwise dislike. Hand written solutions are strictly prohibited.arrow_forward
- write a correct terminology/word on column B that meet the description of column A COLUMN A COLUMN B 1. The site for protein synthesis where mRNA and tRNA meets. 2. Benign tumours or warts that might cause problems but do not spread to oyher parts of the body. 3. A nucleotide sequence that is complimentary to the mRNA codon. 4. A condition that depicts injury or diseased state of liver. 5. Term used to describe a process or condition which affects the general body function. 6. A type of virus that attacks the respiratory system to cause flue 7. The fluid found within the cell 8. A condition which describes harm, damage or impairment of kidney function. 9. To spilt a molecule or chemical bond. 10. The protein coat or shell of a virusarrow_forwardHello, I hope you're doing great! I need help with these worksheets. I need to know the function and the cell form(columnar, Cuboidal, and Squamous, and where the nucleus is located(in the center or the edge of the cell). Ignore my answers, they might be wrong! I am sorry if this is a lot to ask for, but I need to know for my exam Thank you!arrow_forwardComplete what is being asked and finally with the Genetic Code table, determine what specific amino acids will be finally formed. Given DNA strand 3’ T A C T A G C C T A C T G C G 5’ 1. The partner strand of the given _________________________________ 2. The mRNA strand formed _____________________________________ 3. The tRNA _________________________________________________ 4. The amino acids formed are __________________________________arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Understanding Health Insurance: A Guide to Billin...Health & NutritionISBN:9781337679480Author:GREENPublisher:CengageEssentials Health Info Management Principles/Prac...Health & NutritionISBN:9780357191651Author:BowiePublisher:Cengage- Case Studies In Health Information ManagementBiologyISBN:9781337676908Author:SCHNERINGPublisher:Cengage
Understanding Health Insurance: A Guide to Billin...
Health & Nutrition
ISBN:9781337679480
Author:GREEN
Publisher:Cengage
Essentials Health Info Management Principles/Prac...
Health & Nutrition
ISBN:9780357191651
Author:Bowie
Publisher:Cengage
Case Studies In Health Information Management
Biology
ISBN:9781337676908
Author:SCHNERING
Publisher:Cengage
What is Genomics - Full Length; Author: Genome BC;https://www.youtube.com/watch?v=mmgIClg0Y1k;License: Standard youtube license